Details of the Drug Transporter (DTP)

General Information of Drug Transporter (DTP) (ID: DT3BA8L)

DTP Name	Sodium-dependent dopamine transporter (SLC6A3)
Gene Name	SLC6A3
UniProt ID	Q01959 (SC6A3_HUMAN)
VARIDT ID	DTD0455
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Synonyms	DA transporter; DAT; DAT1; PKDYS; PKDYS1; SLC6A3; Solute carrier family 6 member 3
DTP Family	Neurotransmitter:Sodium Symporter (NSS) Family ;
Tissue Specificity	Highly expressed in substantia nigra.
Sequence	MSKSKCSVGLMSSVVAPAKEPNAVGPKEVELILVKEQNGVQLTSSTLTNPRQSPVEAQDR ETWGKKIDFLLSVIGFAVDLANVWRFPYLCYKNGGGAFLVPYLLFMVIAGMPLFYMELAL GQFNREGAAGVWKICPILKGVGFTVILISLYVGFFYNVIIAWALHYLFSSFTTELPWIHC NNSWNSPNCSDAHPGDSSGDSSGLNDTFGTTPAAEYFERGVLHLHQSHGIDDLGPPRWQL TACLVLVIVLLYFSLWKGVKTSGKVVWITATMPYVVLTALLLRGVTLPGAIDGIRAYLSV DFYRLCEASVWIDAATQVCFSLGVGFGVLIAFSSYNKFTNNCYRDAIVTTSINSLTSFSS GFVVFSFLGYMAQKHSVPIGDVAKDGPGLIFIIYPEAIATLPLSSAWAVVFFIMLLTLGI DSAMGGMESVITGLIDEFQLLHRHRELFTLFIVLATFLLSLFCVTNGGIYVFTLLDHFAA GTSILFGVLIEAIGVAWFYGVGQFSDDIQQMTGQRPSLYWRLCWKLVSPCFLLFVVVVSI VTFRPPHYGAYIFPDWANALGWVIATSSMAMVPIYAAYKFCSLPGSFREKLAYAIAPEKD RELVDRGEVRQFTLRHWLKV
Function	This transporter can terminate the action of dopamine by its high affinity sodium-dependent reuptake into presynaptic terminals.
Endogenous Substrate(s)	Cl-; Na+
TCDB ID	2.A.22.1.3
Gene ID	6531
KEGG Pathway	Synaptic vesicle cycle (hsa04721 ) Dopaminergic synapse (hsa04728 ) Parkinson disease (hsa05012 ) Pathways of neurodegeneration - multiple diseases (hsa05022 ) Cocaine addiction (hsa05030 ) Amphetamine addiction (hsa05031 ) Alcoholism (hsa05034 )
Reactome Pathway	Na+/Cl- dependent neurotransmitter transporters (R-HSA-442660 ) Defective SLC6A3 causes Parkinsonism-dystonia infantile (PKDYS) (R-HSA-5619081 ) Defective SLC6A3 causes Parkinsonism-dystonia infantile (PKDYS) (R-HSA-5660724 ) Dopamine clearance from the synaptic cleft (R-HSA-379401 )

Molecular Interaction Atlas (MIA) of This DTP

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DTP

5 Approved Drug(s) Transported by This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amphetamine	DMSZQAK	Attention deficit hyperactivity disorder	6A05.Z	Approved	[88]
Benztropine	DMGZOVN	Parkinson disease	8A00.0	Approved	[89]
Bretylium	DM1FX74	Ventricular fibrillation	BC71.1	Approved	[90]
Dopamine	DMPGUCF	Parkinson disease	8A00.0	Approved	[91]
OPC-34712	DMHG57U	Major depressive disorder	6A70.3	Approved	[92]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DTP

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DTP

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	2.40E-05	1.43E-01	5.91E-01
Adrenocortical carcinoma	2D11.Z	Kidney	6.58E-01	-5.96E-02	-2.70E-01
Alopecia	ED70	Skin from scalp	9.61E-01	-3.63E-02	-1.71E-01
Alzheimer's disease	8A20	Entorhinal cortex	2.11E-01	1.59E-02	5.57E-02
Ankylosing spondylitis	FA92.0	Pheripheral blood	7.44E-01	-5.93E-02	-5.60E-01
Aortic stenosis	BB70	Calcified aortic valve	1.28E-01	1.62E-01	4.08E-01
Apnea	7A40	Hyperplastic tonsil	2.06E-01	-1.10E-01	-1.20E+00
Arthropathy	FA00-FA5Z	Peripheral blood	4.52E-01	4.92E-02	3.14E-01
Asthma	CA23	Nasal and bronchial airway	8.82E-01	8.73E-02	2.07E-01
Atopic dermatitis	EA80	Skin	8.95E-01	1.91E-03	1.31E-02
Autism	6A02	Whole blood	7.76E-01	-1.66E-02	-7.74E-02
Autoimmune uveitis	9A96	Peripheral monocyte	2.02E-01	-8.98E-02	-7.56E-01
Autosomal dominant monocytopenia	4B04	Whole blood	8.06E-01	-4.08E-02	-2.74E-01
Bacterial infection of gingival	1C1H	Gingival tissue	1.71E-04	1.09E-01	4.76E-01
Batten disease	5C56.1	Whole blood	1.77E-01	8.43E-02	6.92E-01
Behcet's disease	4A62	Peripheral blood	6.83E-01	-7.24E-03	-4.07E-02
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	6.12E-01	4.71E-03	2.90E-02
Bladder cancer	2C94	Bladder tissue	7.12E-01	2.26E-02	1.53E-01
Breast cancer	2C60-2C6Z	Breast tissue	2.37E-01	3.26E-02	1.51E-01
Cardioembolic stroke	8B11.20	Whole blood	3.13E-03	2.02E-01	1.34E+00
Cervical cancer	2C77	Cervical tissue	2.52E-03	-1.02E-01	-7.15E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	2.18E-01	-6.97E-03	-1.95E-02
Chronic hepatitis C	1E51.1	Whole blood	8.84E-03	2.16E-01	1.54E+00
Chronic obstructive pulmonary disease	CA22	Lung tissue	7.63E-01	-2.77E-02	-1.47E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.34E-01	9.53E-02	4.05E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	3.17E-01	-6.18E-02	-3.36E-01
Colon cancer	2B90	Colon tissue	1.57E-01	4.61E-02	1.91E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	4.08E-01	9.30E-02	3.90E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	3.11E-01	-2.04E-01	-7.15E-01
Endometriosis	GA10	Endometrium tissue	6.60E-01	3.06E-02	1.54E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	7.75E-01	-5.65E-03	-4.37E-02
Familial hypercholesterolemia	5C80.00	Whole blood	4.80E-01	1.71E-02	8.10E-02
Gastric cancer	2B72	Gastric tissue	1.75E-01	1.40E-01	7.95E-01
Glioblastopma	2A00.00	Nervous tissue	7.92E-06	8.67E-02	9.70E-02
Glioma	2A00.0Y-2A00.0Z	White matter tissue	1.10E-01	-1.30E-01	-3.97E-01
Head and neck cancer	2D42	Head and neck tissue	3.03E-02	6.51E-02	3.50E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	1.26E-01	-9.36E-02	-6.43E-01
Huntington's disease	8A01.10	Whole blood	8.93E-01	0.00E+00	0.00E+00
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	9.27E-01	1.98E-02	1.70E-01
Immunodeficiency	4A00-4A20	Peripheral blood	6.42E-01	5.19E-03	4.01E-02
Influenza	1.00E+30	Whole blood	5.06E-02	4.18E-01	2.65E+00
Interstitial cystitis	GC00.3	Bladder tissue	3.75E-01	4.20E-02	4.88E-01
Intracranial aneurysm	8B01.0	Intracranial artery	2.28E-03	2.12E-01	8.87E-01
Irritable bowel syndrome	DD91.0	Rectal colon tissue	3.92E-01	-4.41E-02	-1.50E-01
Ischemic stroke	8B11	Peripheral blood	1.73E-01	5.61E-02	4.07E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	8.70E-02	1.39E-02	5.02E-02
Lateral sclerosis	8B60.4	Cervical spinal cord	4.01E-01	2.11E-01	1.01E+00
Lateral sclerosis	8B60.4	Skin	3.74E-01	1.01E-01	6.99E-01
Liver cancer	2C12.0	Liver tissue	2.73E-02	-1.25E-01	-5.77E-01
Liver failure	DB99.7-DB99.8	Liver tissue	6.92E-01	1.04E-03	4.37E-03
Lung cancer	2C25	Lung tissue	2.47E-47	2.43E-01	1.10E+00
Lupus erythematosus	4A40	Whole blood	1.43E-01	-1.40E-01	-2.14E-01
Major depressive disorder	6A70-6A7Z	Whole blood	8.42E-01	3.31E-02	1.42E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	4.17E-01	4.04E-03	2.45E-02
Melanoma	2C30	Skin	4.18E-02	4.16E-01	7.63E-01
Multiple myeloma	2A83.1	Bone marrow	1.25E-04	4.19E-01	2.56E+00
Multiple myeloma	2A83.1	Peripheral blood	4.71E-01	1.06E-02	5.88E-02
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	4.97E-01	-7.58E-02	-2.51E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	4.67E-01	-6.54E-02	-3.60E-01
Myelofibrosis	2A20.2	Whole blood	1.63E-01	-5.36E-02	-4.56E-01
Myocardial infarction	BA41-BA50	Peripheral blood	9.66E-02	3.27E-01	6.31E-01
Myopathy	8C70.6	Muscle tissue	1.13E-01	-6.96E-02	-4.77E-01
Neonatal sepsis	KA60	Whole blood	2.92E-01	3.64E-02	1.48E-01
Neuroectodermal tumour	2A00.11	Brain stem tissue	2.61E-05	2.96E-01	6.76E-01
Non-alcoholic fatty liver disease	DB92	Liver tissue	6.20E-01	5.38E-02	2.46E-01
Obesity related type 2 diabetes	5A11	Omental adipose tissue	7.63E-01	-1.21E-01	-5.94E-01
Olive pollen allergy	CA08.00	Peripheral blood	9.45E-01	-1.94E-01	-4.45E-01
Oral cancer	2B6E	Oral tissue	6.65E-01	-5.55E-03	-2.04E-02
Osteoarthritis	FA00-FA0Z	Synovial tissue	5.31E-01	-8.97E-02	-4.32E-01
Osteoporosis	FB83.1	Bone marrow	2.42E-02	6.22E-01	4.57E+00
Ovarian cancer	2C73	Ovarian tissue	2.41E-02	-1.99E-01	-6.56E-01
Pancreatic cancer	2C10	Pancreas	8.23E-03	-3.27E-01	-8.79E-01
Parkinson's disease	8A00.0	Substantia nigra tissue	1.08E-03	-3.08E+00	-1.99E+00
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	7.45E-01	-3.79E-03	-3.55E-02
Pituitary cancer	2D12	Pituitary tissue	2.09E-01	1.43E-01	4.31E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	8.11E-01	-5.84E-02	-1.77E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	7.38E-01	-4.04E-03	-2.37E-02
Polycythemia vera	2A20.4	Whole blood	5.13E-02	-5.21E-02	-4.12E-01
Pompe disease	5C51.3	Biceps muscle	8.40E-01	8.55E-02	4.81E-01
Preterm birth	KA21.4Z	Myometrium	7.34E-01	-3.24E-02	-2.30E-01
Prostate cancer	2C82	Prostate	4.56E-03	-6.57E-01	-1.02E+00
Psoriasis	EA90	Skin	6.58E-11	-2.68E-01	-5.92E-01
Rectal cancer	2B92	Rectal colon tissue	1.04E-01	-1.44E-01	-8.57E-01
Renal cancer	2C90-2C91	Kidney	9.53E-16	1.10E+00	3.12E+00
Retinoblastoma	2D02.2	Uvea	6.57E-02	1.10E-01	8.03E-01
Rheumatoid arthritis	FA20	Synovial tissue	6.45E-01	4.65E-02	1.08E-01
Rhinovirus infection	CA42.1	Nasal epithelium tissue	5.44E-01	7.16E-03	4.81E-02
Schizophrenia	6A20	Prefrontal cortex	7.05E-01	-7.30E-03	-4.08E-02
Schizophrenia	6A20	Superior temporal cortex	5.94E-01	-3.30E-02	-1.96E-01
Scleroderma	4A42.Z	Whole blood	6.64E-02	1.33E-01	7.46E-01
Seizure	8A60-8A6Z	Whole blood	7.73E-01	3.41E-03	1.34E-02
Sensitive skin	EK0Z	Skin	4.44E-01	4.57E-03	2.59E-02
Sepsis with septic shock	1G41	Whole blood	1.60E-04	9.13E-02	4.00E-01
Shwachman-Diamond syndrome	3A70.0	Bone marrow	4.35E-01	2.03E-02	1.81E-01
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	5.24E-01	-1.65E-02	-5.46E-02
Simpson golabi behmel syndrome	LD2C	Adipose tissue	3.13E-01	7.42E-02	8.98E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	3.88E-02	-4.17E-01	-2.13E+00
Skin cancer	2C30-2C3Z	Skin	2.82E-03	-2.65E-01	-4.31E-01
Thrombocythemia	3B63	Whole blood	2.57E-01	-1.01E-01	-8.06E-01
Thrombocytopenia	3B64	Whole blood	8.02E-01	-4.42E-03	-1.17E-02
Thyroid cancer	2D10	Thyroid	1.32E-04	-2.29E-01	-7.43E-01
Tibial muscular dystrophy	8C75	Muscle tissue	4.88E-02	-1.69E-01	-1.14E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	2.31E-01	2.20E-01	1.42E+00
Type 2 diabetes	5A11	Liver tissue	2.72E-01	-1.52E-01	-6.81E-01
Ureter cancer	2C92	Urothelium	5.95E-01	-5.05E-02	-2.80E-01
Uterine cancer	2C78	Endometrium tissue	1.54E-07	-1.41E-01	-5.14E-01
Vitiligo	ED63.0	Skin	3.63E-01	8.85E-02	7.49E-01
------------------------------------------------------------------------------------


⏷ Show the Full List of Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DTP

DTP DTT Name

Dopamine transporter (DAT) DTT Info

DTP DTT Type

Successful

Related Disease

Attention deficit hyperactivity disorder [ICD-11: 6A05]

Corneal disease [ICD-11: 9A76-9A78]

Narcolepsy [ICD-11: 7A20]

Obesity [ICD-11: 5B80-5B81]

Parkinsonism [ICD-11: 8A00]

Bipolar disorder [ICD-11: 6A60]

8 Approved Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Altropane	DMO9WDS	Attention deficit hyperactivity disorder	6A05.Z	Approved	[1]
Cocaine	DMSOX7I	Anaesthesia	9A78.6	Approved	[2]
Dasotraline	DMLDQFV	Attention deficit hyperactivity disorder	6A05.Z	Approved	[3]
Dexmethylphenidate hydrochloride	DM8WBAH	Attention deficit hyperactivity disorder	6A05.Z	Approved	[4]
Ioflupane I-123	DMNARJT	Parkinson disease	8A00.0	Approved	[5]
Methylphenidate	DM7SJD6	Attention deficit hyperactivity disorder	6A05.Z	Approved	[6]
Modafinil	DMYILBE	Narcolepsy	7A20	Approved	[7]
Phenmetrazine	DMXYTN9	Obesity	5B81	Approved	[8]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Approved Drug(s)

8 Clinical Trial Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amitifadine	DMS1X67	Obesity	5B81	Phase 3	[9]
Bupropion+Naltrexone	DMAR9ND	Obesity	5B81	Phase 3	[10]
NAV5001	DMRSI1M	Dementia	6D80-6D86	Phase 3	[1]
MIN-117	DMSLIW6	Major depressive disorder	6A70.3	Phase 2	[11]
NS 2359	DMI5HFU	Cocaine addiction	6C45.2	Phase 2	[12], [13]
Spiroglumide	DM7NJWY	Stomach disease	DA43-DA4Y	Phase 2	[14]
GSK-1360707	DMZC9XU	Major depressive disorder	6A70.3	Phase 1	[15]
RTI-336	DMY8D5O	Cocaine addiction	6C45.2	Phase 1	[16]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Clinical Trial Drug(s)

12 Discontinued Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Amineptine	DMGVNJ7	Major depressive disorder	6A70.3	Withdrawn from market	[17]
DOV-216303	DMTE14H	Mood disorder	6A60-6E23	Discontinued in Phase 2	[12]
Manifaxine	DMRN7GC	Major depressive disorder	6A70.3	Discontinued in Phase 2	[18]
NS-2389	DMVRJ8D	Major depressive disorder	6A70.3	Discontinued in Phase 2	[19]
Radafaxine	DMARQE0	Major depressive disorder	6A70.3	Discontinued in Phase 2	[20], [21]
SPD-473	DMTJNRL	Mood disorder	6A60-6E23	Discontinued in Phase 2	[22]
KP106	DMICLMR	Attention deficit hyperactivity disorder	6A05.Z	Discontinued in Phase 1	[23]
NSD-644	DMNL9DS	Neurological disorder	6B60	Discontinued in Phase 1	[24]
RG-7166	DMKLPMW	Major depressive disorder	6A70.3	Discontinued in Phase 1	[25]
Vanoxerine	DMBQPA5	Cocaine addiction	6C45.2	Discontinued in Phase 1	[26]
Fluoratec	DM7JT3D	Attention deficit hyperactivity disorder	6A05.Z	Terminated	[27]
Seridopidine	DMTBWU1	Neurological disorder	6B60	Terminated	[28]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Discontinued Drug(s)

252 Investigative Drug(s) Targeting This DTP

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
(+/-)-3-((naphthalen-2-yloxy)methyl)pyrrolidine	DML68KX	Discovery agent	N.A.	Investigative	[29]
(+/-)-threo-3',4'-Dichloromethylphenidate amide	DMFSZ8H	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-3',4'-Dichlororitalinol methyl ether	DM5MLZ0	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-3',5'-Dichloromethylphenidate	DM4UQBI	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-3',5'-Dimethylmethylphenidate	DMUWKNX	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-3-Fluororitalinol	DM3O4FI	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-4'-Ethylmethylphenidate	DMU5T28	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-Benzylphenidate	DM9TSW0	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-Methylphenidate amide	DMRZOVP	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(2-Chlorobenzyl)methylphenidate	DM80JOH	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(2-Methylfuran)methylphenidate	DM6CWBO	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(2-Methylpyridine)methylphenidate	DMN6ZX9	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(2-Methylthiopene)methylphenidate	DMWUGSV	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(2-Phenylethyl)methylphenidate	DM2WRED	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(2-Phenylethyl)ritalinol	DM9Y3MT	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(3-Chlorobenzyl)methylphenidate	DMU08WO	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(3-Methylfuran)methylphenidate	DMHPE4L	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(3-Methylpyridine)methylphenidate	DMDMTZK	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(3-Methylthiopene)methylphenidate	DMIJ7PC	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(3-Phenylpropyl)methylphenidate	DMD926H	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(3-Phenylpropyl)ritalinol	DMVP183	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(4-Chlorobenzyl)methylphenidate	DM3HWQY	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(4-Methoxybenzyl)methylphenidate	DMHIKD2	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(4-Methylpyridine)methylphenidate	DM9QIAL	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(4-Nitrobenzyl)methylphenidate	DMB3JY8	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(4-Phenylbutyl)methylphenidate	DMK6IJW	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(4-Phenylbutyl)ritalinol	DMG3FA1	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(5-Phenylpentyl)methylphenidate	DMHNQO9	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-(6-Phenylhexyl)methylphenidate	DMG1K5H	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-Allylmethylphenidate	DMYNO71	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-Benzyl-3',4'-dichlororitalinol	DMOJXCK	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-Benzyl-3'-chloromethylphenidate	DM15LE0	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-Benzylmethylphenidate amide	DMUACDH	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-Methyl-30-methylmethylphenidate	DM6D18M	Discovery agent	N.A.	Investigative	[30]
(+/-)-threo-N-Propargylmethylphenidate	DMYE0MZ	Discovery agent	N.A.	Investigative	[30]
(1-Phenyl-ethyl)-(2-phenyl-quinazolin-4-yl)-amine	DMECH9W	Discovery agent	N.A.	Investigative	[31]
(2R,3R)-iodoreboxetine	DMYRHFI	Discovery agent	N.A.	Investigative	[32]
(2R,3S)-2-[(2-Iodophenoxy)phenylmethyl]morpholine	DMY2FX8	Discovery agent	N.A.	Investigative	[33]
(2R,3S)-2-[(3-Iodophenoxy)phenylmethyl]morpholine	DM260TI	Discovery agent	N.A.	Investigative	[33]
(2R,3S)-2-[(4-Iodophenoxy)phenylmethyl]morpholine	DMKM8E2	Discovery agent	N.A.	Investigative	[33]
(2S,3S)-2-(m-Tolyl)-3,5,5-trimethylmorpholin-2-ol	DMDUI8R	Discovery agent	N.A.	Investigative	[34]
(2S,3S)-2-Phenyl-3,5,5-trimethylmorpholin-2-ol	DMDUGZS	Discovery agent	N.A.	Investigative	[34]
(2S,3S)-iodoreboxetine	DMBEOIQ	Discovery agent	N.A.	Investigative	[32]
(cis)-1,6-diphenyl-3-aza-bicyclo[3.1.0]hexane	DMMC139	Discovery agent	N.A.	Investigative	[35]
(R)-2-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol	DM74IWX	Discovery agent	N.A.	Investigative	[36]
(R)-3-(naphthalen-2-ylmethoxy)pyrrolidine	DM94B12	Discovery agent	N.A.	Investigative	[29]
(R)-DULOXETINE	DMECK7H	Discovery agent	N.A.	Investigative	[37]
(R)-N-isobutyl-N-(pyrrolidin-3-yl)-2-naphthamide	DMJFH97	Discovery agent	N.A.	Investigative	[38]
(R)-Norfluoxetine	DMS30KU	Discovery agent	N.A.	Investigative	[39]
(RS/SR)-2-[1-(3,4-dichlorophenyl)butyl]piperidine	DM6EYQ2	Discovery agent	N.A.	Investigative	[40]
(RS/SR)-2-[1-(4-chlorophenyl)butyl]piperidine	DMGHWJ5	Discovery agent	N.A.	Investigative	[40]
(RS/SR)-2-[1-(4-chlorophenyl)ethyl]piperidine	DMAIGM2	Discovery agent	N.A.	Investigative	[40]
(RS/SR)-2-[1-(4-chlorophenyl)hexyl]piperidine	DMDVMSP	Discovery agent	N.A.	Investigative	[40]
(RS/SR)-2-[1-(4-chlorophenyl)pentyl]piperidine	DMMUV7R	Discovery agent	N.A.	Investigative	[40]
(RS/SR)-2-[1-(4-chlorophenyl)propyl]piperidine	DMPQAGL	Discovery agent	N.A.	Investigative	[40]
(S)-3-(naphthalen-2-ylmethoxy)pyrrolidine	DM5ILK1	Discovery agent	N.A.	Investigative	[29]
(S)-Norfluoxetine	DM8ZTPF	Discovery agent	N.A.	Investigative	[39]
1-(1,4-diphenylbutan-2-yl)piperazine	DM8Z1QU	Discovery agent	N.A.	Investigative	[41]
1-(1-(4-FLUOROPHENYL)-2-(2-(TRIFLUOROMETHOXY)PHENYL)ETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMS9PZ7	Discovery agent	N.A.	Investigative	[36]
1-(1-(benzo[b]thiophen-2-yl)cyclohexyl)piperidine	DMPGM0V	Discovery agent	N.A.	Investigative	[42]
1-(1-Benzo[b]thiophen-2-yl-cycloheptyl)-azepane	DM2T1CD	Discovery agent	N.A.	Investigative	[43]
1-(1-Benzo[b]thiophen-2-yl-cyclohexyl)-azepane	DMEFP15	Discovery agent	N.A.	Investigative	[43]
1-(1-Benzo[b]thiophen-2-yl-cyclopentyl)-azepane	DM1Q36W	Discovery agent	N.A.	Investigative	[43]
1-(1-phenyl-2-(2-propoxyphenyl)ethyl)piperazine	DM54ZKU	Discovery agent	N.A.	Investigative	[36]
1-(2,3-Dihydro-1H-indol-5-ylmethyl)-propylamine	DM0URSE	Discovery agent	N.A.	Investigative	[44]
1-(2-(2-(DIFLUOROMETHOXY)PHENYL)-1-PHENYLETHYL)PIPERAZINE (ENANTIOMERIC MIX)	DMUJ2WB	Discovery agent	N.A.	Investigative	[36]
1-(2-(2-chlorophenyl)-1-phenylethyl)piperazine	DMUM4YQ	Discovery agent	N.A.	Investigative	[45]
1-(2-(2-methoxyphenyl)-1-phenylethyl)piperazine	DM2H38V	Discovery agent	N.A.	Investigative	[45]
1-(2-(4-fluorophenoxy)phenyl)piperazine	DMU082P	Discovery agent	N.A.	Investigative	[46]
1-(2-(phenoxymethyl)phenyl)piperazine	DM7Z19T	Discovery agent	N.A.	Investigative	[46]
1-(2-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMBWCOZ	Discovery agent	N.A.	Investigative	[47]
1-(2-phenoxyphenyl)piperazine	DMWFCYN	Discovery agent	N.A.	Investigative	[46]
1-(3,4-Dichloro-phenyl)-3-diethylamino-indan-5-ol	DMN4JU0	Discovery agent	N.A.	Investigative	[48]
1-(3,4-Dichloro-phenyl)-3-methylamino-indan-5-ol	DMWIEDN	Discovery agent	N.A.	Investigative	[48]
1-(3-bromophenyl)-2-(tert-butylamino)propan-1-one	DM2SEXH	Discovery agent	N.A.	Investigative	[49]
1-(3-chlorophenyl)-2-(dimethylamino)propan-1-one	DMFYJ5V	Discovery agent	N.A.	Investigative	[49]
1-(3-chlorophenyl)-2-(piperidin-1-yl)propan-1-one	DMPOVUY	Discovery agent	N.A.	Investigative	[49]
1-(3-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMPEZ1V	Discovery agent	N.A.	Investigative	[47]
1-(3-methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMB9T6F	Discovery agent	N.A.	Investigative	[47]
1-(4-aminophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMY7TDZ	Discovery agent	N.A.	Investigative	[50]
1-(4-bromophenyl)-2-(tert-butylamino)propan-1-one	DMW6YDK	Discovery agent	N.A.	Investigative	[49]
1-(4-bromophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMPLEC0	Discovery agent	N.A.	Investigative	[47]
1-(4-fluorophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DM6ARQF	Discovery agent	N.A.	Investigative	[47]
1-(4-iodophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DMBV8PT	Discovery agent	N.A.	Investigative	[47]
1-(4-nitrophenyl)-2-pyrrolidin-1-yl-pentan-1-one	DME435S	Discovery agent	N.A.	Investigative	[47]
1-(benzofuran-2-yl)-3-aza-bicyclo[3.1.0]hexane	DMGNL2A	Discovery agent	N.A.	Investigative	[35]
1-(naphthalen-2-yl)-3-aza-bicyclo[3.1.0]hexane	DMUEQC8	Discovery agent	N.A.	Investigative	[35]
1-(thiophen-2-yl)-3-aza-bicyclo[3.1.0]hexane	DM6J1AK	Discovery agent	N.A.	Investigative	[35]
1-Benzo[b]thiophen-2-yl-cycloheptylamine	DMMN5TA	Discovery agent	N.A.	Investigative	[43]
1-Benzo[b]thiophen-2-yl-cyclohexylamine	DMR97FU	Discovery agent	N.A.	Investigative	[43]
1-Benzo[b]thiophen-2-yl-cyclopentylamine	DM6EF1L	Discovery agent	N.A.	Investigative	[43]
1-benzylpiperidine hydrochloride	DM7GDEK	Discovery agent	N.A.	Investigative	[4]
1-Biphenyl-4-yl-3-aza-bicyclo[3.1.0]hexane	DM6E7TA	Discovery agent	N.A.	Investigative	[35]
1-naphthalen-2-yl-2-pyrrolidin-1-yl-pentan-1-one	DMU04ZQ	Discovery agent	N.A.	Investigative	[47]
1-phenyl-1-(piperidin-2-yl)propan-2-one	DM0DH98	Discovery agent	N.A.	Investigative	[40]
1-phenyl-3-aza-bicyclo[3.1.0]hexane	DMUA72F	Discovery agent	N.A.	Investigative	[35]
10R-hydroxylobel-7-ene	DM8XRCT	Discovery agent	N.A.	Investigative	[51]
10R-hydroxylobelane	DMN93QT	Discovery agent	N.A.	Investigative	[51]
10S-hydroxylobel-7-ene	DMN1YQ6	Discovery agent	N.A.	Investigative	[51]
10S-hydroxylobelane	DM54AKV	Discovery agent	N.A.	Investigative	[51]
1S,2R-milnacipran	DM7Y5AN	Discovery agent	N.A.	Investigative	[52]
2-((2-iodophenoxy)(phenyl)methyl)morpholine	DMS1AOK	Discovery agent	N.A.	Investigative	[53]
2-((3-iodophenyl)(o-tolyloxy)methyl)morpholine	DMS21CR	Discovery agent	N.A.	Investigative	[53]
2-(2'-Aminoethyl)-5-benzyltetrahydrofuran	DMVTD1F	Discovery agent	N.A.	Investigative	[54]
2-(2,3-Dihydro-1H-indol-5-yl)-1-methyl-ethylamine	DM56NK4	Discovery agent	N.A.	Investigative	[44]
2-(2-chlorophenoxy)-3-(piperidin-4-yl)pyridine	DM1ULEX	Discovery agent	N.A.	Investigative	[55]
2-(2-methoxyphenoxy)-3-(piperidin-4-yl)pyridine	DMYVDJQ	Discovery agent	N.A.	Investigative	[55]
2-(Aminomethyl)-5-(1'-naphthyl)tetrahydrofuran	DMCUTY9	Discovery agent	N.A.	Investigative	[54]
2-(Aminomethyl)-5-(2'-naphthyl)tetrahydrofuran	DM157SO	Discovery agent	N.A.	Investigative	[54]
2-(Aminomethyl)-5-phenethyltetrahydrofuran	DMEZ7O2	Discovery agent	N.A.	Investigative	[54]
2-(N,N-Diethylamino)-3'-chloropropiophenone	DMVR248	Discovery agent	N.A.	Investigative	[56]
2-(N-Cyclopentylamino)-3'-bromopropiophenone	DML4GHA	Discovery agent	N.A.	Investigative	[49]
2-(N-Cyclopentylamino)-3'-chloropropiophenone	DMP68CE	Discovery agent	N.A.	Investigative	[56]
2-(N-Cyclopentylamino)-3'-fluoropropiophenone	DMH6FKX	Discovery agent	N.A.	Investigative	[49]
2-(N-Cyclopentylamino)-3'-methoxypropiophenone	DMVN1UI	Discovery agent	N.A.	Investigative	[49]
2-(N-Cyclopentylamino)-3'-methylpropiophenone	DMG87RK	Discovery agent	N.A.	Investigative	[49]
2-(N-Cyclopropylamino)-3-chloropropiophenone	DMNMES3	Discovery agent	N.A.	Investigative	[56]
2-(N-Isopropylamino)-3'-chloropropiophenone	DMCK7SV	Discovery agent	N.A.	Investigative	[56]
2-(N-Pyrrolidinyl)-3'-bromopropiophenone	DM85ZCW	Discovery agent	N.A.	Investigative	[49]
2-(N-Pyrrolidinyl)-3'-fluoropropiophenone	DMYPOC5	Discovery agent	N.A.	Investigative	[49]
2-(N-Pyrrolidinyl)-3'-methoxypropiophenone	DM1W3L9	Discovery agent	N.A.	Investigative	[49]
2-(N-Pyrrolidinyl)-3'-methylpropiophenone	DMGKXOI	Discovery agent	N.A.	Investigative	[49]
2-(N-Pyrrolidinyl)-3'-nitropropiophenone	DM1I9LQ	Discovery agent	N.A.	Investigative	[49]
2-(N-tert-Butylamino)-3',4'-dichloropropiophenone	DMKIEVP	Discovery agent	N.A.	Investigative	[56]
2-(N-tert-Butylamino)-3'-chloroheptanophenone	DMY2PBO	Discovery agent	N.A.	Investigative	[56]
2-(N-tert-Butylamino)-3'-chlorohexanophenone	DMPO3CJ	Discovery agent	N.A.	Investigative	[56]
2-(N-tert-Butylamino)-3'-chlorooctanophenone	DMW47VA	Discovery agent	N.A.	Investigative	[56]
2-(N-tert-Butylamino)-3'-chloropentanophenone	DMTZ540	Discovery agent	N.A.	Investigative	[56]
2-(N-tert-Butylamino)-4'-chloropropiophenone	DME1SP4	Discovery agent	N.A.	Investigative	[56]
2-(N-tert-Butylamino)propiophenone	DM9E5LT	Discovery agent	N.A.	Investigative	[56]
2-(tert-butylamino)-1-(3-chlorophenyl)butan-1-one	DMI457Y	Discovery agent	N.A.	Investigative	[49]
2-(tert-butylamino)-1-m-tolylpropan-1-one	DM6PV4W	Discovery agent	N.A.	Investigative	[49]
2-(tert-butylamino)-1-p-tolylpropan-1-one	DMYFQDT	Discovery agent	N.A.	Investigative	[49]
2-(tert-Butylamino)-3',4'-dichlorobutyrophenone	DMOJK8Y	Discovery agent	N.A.	Investigative	[56]
2-(tert-Butylamino)-3',4'-dichloropentanophenone	DMMUDQ7	Discovery agent	N.A.	Investigative	[56]
2-(tert-Butylamino)-3',5'-difluoropropiophenone	DMH3QLF	Discovery agent	N.A.	Investigative	[56]
2-(tert-Butylamino)-3'-fluoropropiophenone	DM5YJP3	Discovery agent	N.A.	Investigative	[56]
2-Amino-1-(4-methylthiophenyl)propane	DMJ2Z9G	Discovery agent	N.A.	Investigative	[57]
2-Aminomethyl-5-(p-bromophenyl)tetrahydrofuran	DMCJUWK	Discovery agent	N.A.	Investigative	[54]
2-Aminomethyl-5-(p-chlorophenyl)tetrahydrofuran	DM3OTZY	Discovery agent	N.A.	Investigative	[54]
2-Aminomethyl-5-(p-methoxyphenyl)tetrahydrofuran	DMDG8FL	Discovery agent	N.A.	Investigative	[54]
2-Aminomethyl-5-(p-t-butylphenyl)tetrahydrofuran	DME4P7K	Discovery agent	N.A.	Investigative	[54]
2-Aminomethyl-5-(phenyl)tetrahydrofuran	DM413ZB	Discovery agent	N.A.	Investigative	[54]
2-phenoxy-3-(piperidin-4-yl)pyridine	DM6JNT5	Discovery agent	N.A.	Investigative	[55]
2-phenylpiperidine hydrochloride	DM7OHSX	Discovery agent	N.A.	Investigative	[4]
2pyrrolidin-1-yl-1-phenylpentan-1-one	DMBJXCF	Discovery agent	N.A.	Investigative	[47]
3-(2-phenyl-2-(piperazin-1-yl)ethyl)phenol	DM6QZTB	Discovery agent	N.A.	Investigative	[45]
3-(3,4-dichlorophenyl)-2-nortropene	DMT3AW8	Discovery agent	N.A.	Investigative	[58]
3-(4-Chlorophenyl)-2-nortropene	DM71EUO	Discovery agent	N.A.	Investigative	[58]
3-(4-Fluorophenyl)-2-nortropene	DM8CK9M	Discovery agent	N.A.	Investigative	[58]
3-(4-Trifluoromethylphenyl)-2-nortropene	DMZB804	Discovery agent	N.A.	Investigative	[58]
3-alpha-Phenylmethoxy-3-beta-phenyl-nortropane	DMO5IJA	Discovery agent	N.A.	Investigative	[58]
3-p-Tolyl-8-aza-bicyclo[3.2.1]octane	DM0872E	Discovery agent	N.A.	Investigative	[59]
3-Phenyl-2-nortropene	DMAJMU6	Discovery agent	N.A.	Investigative	[58]
3alpha-(bis-chloro-phenylmethoxy)tropane	DMBUZWQ	Discovery agent	N.A.	Investigative	[60]
4-(1H-indol-3-yl)-N,N-dimethylcyclohex-3-enamine	DM7Y1ZD	Discovery agent	N.A.	Investigative	[61]
4-(2-((3-fluorophenoxy)methyl)phenyl)piperidine	DMJ9CNA	Discovery agent	N.A.	Investigative	[46]
4-(2-(2-fluoro-5-methylphenoxy)phenyl)piperidine	DM9UA0N	Discovery agent	N.A.	Investigative	[46]
4-(2-(2-fluorobenzyloxy)phenyl)piperidine	DMCR3VM	Discovery agent	N.A.	Investigative	[46]
4-(2-(3-chlorophenoxy)phenyl)piperidine	DM0IT5E	Discovery agent	N.A.	Investigative	[46]
4-(2-(3-fluorophenoxy)-4-methylphenyl)piperidine	DMEPB9L	Discovery agent	N.A.	Investigative	[46]
4-(2-(3-fluorophenoxy)phenyl)piperidine	DMZMEOG	Discovery agent	N.A.	Investigative	[46]
4-(2-(4-fluorobenzyloxy)phenyl)piperidine	DM29QLG	Discovery agent	N.A.	Investigative	[46]
4-(2-(4-fluorophenoxy)-4-methylphenyl)piperidine	DMJNB8C	Discovery agent	N.A.	Investigative	[46]
4-(2-(4-fluorophenoxy)phenyl)piperidine	DMFQT9O	Discovery agent	N.A.	Investigative	[46]
4-(2-(benzyloxy)-3-fluorophenyl)piperidine	DMM2NHZ	Discovery agent	N.A.	Investigative	[46]
4-(2-(benzyloxy)-6-fluorophenyl)piperidine	DMF3S50	Discovery agent	N.A.	Investigative	[46]
4-(2-(benzyloxy)phenyl)piperidine	DMOC7PY	Discovery agent	N.A.	Investigative	[46]
4-(2-(phenoxymethyl)phenyl)piperidine	DM0OFRQ	Discovery agent	N.A.	Investigative	[46]
4-(2-fluoro-6-(2-fluorophenoxy)phenyl)piperidine	DMQUAP2	Discovery agent	N.A.	Investigative	[55]
4-(2-fluoro-6-(3-fluorophenoxy)phenyl)piperidine	DMUBHRF	Discovery agent	N.A.	Investigative	[46]
4-(2-fluoro-6-(4-fluorophenoxy)phenyl)piperidine	DMJ2GW0	Discovery agent	N.A.	Investigative	[46]
4-(2-fluoro-6-phenoxyphenyl)piperidine	DMXIGWC	Discovery agent	N.A.	Investigative	[46]
4-(2-phenoxyphenyl)piperidine	DMB5IFA	Discovery agent	N.A.	Investigative	[46]
4-(2-pyrrolidin-1-yl-pentanoyl)benzonitrile	DMOSDAN	Discovery agent	N.A.	Investigative	[47]
4-(3-fluoro-2-phenoxyphenyl)piperidine	DM1C3NZ	Discovery agent	N.A.	Investigative	[46]
4-(4-butylpiperidin-1-yl)-1-o-tolylbutan-1-one	DMM9X0G	Discovery agent	N.A.	Investigative	[62]
4-[(diphenylmethyl)amino]-2-phenylquinazoline	DMT1PM4	Discovery agent	N.A.	Investigative	[31]
6-(3-aza-bicyclo[3.1.0]hexan-1-yl)quinoline	DMKFDQ7	Discovery agent	N.A.	Investigative	[35]
6-(piperidin-4-ylmethoxy)-2-naphthonitrile	DMBQKGY	Discovery agent	N.A.	Investigative	[29]
7-(piperidin-4-ylmethoxy)-2-naphthonitrile	DM6I5K1	Discovery agent	N.A.	Investigative	[29]
8-Methyl-3-p-tolyl-8-aza-bicyclo[3.2.1]octane	DMOM4VS	Discovery agent	N.A.	Investigative	[59]
8R-hydroxylobel-9-ene	DML9HDA	Discovery agent	N.A.	Investigative	[63]
8R-hydroxylobelane	DMJ82TO	Discovery agent	N.A.	Investigative	[51]
8S-hydroxylobel-9-ene	DMRL3BK	Discovery agent	N.A.	Investigative	[51]
8S-hydroxylobelane	DMLONTS	Discovery agent	N.A.	Investigative	[51]
AMINOBENZTROPINE	DMT13EW	Discovery agent	N.A.	Investigative	[64]
ANOLOBINE	DM6DYZ0	Discovery agent	N.A.	Investigative	[65]
ANONAINE	DMM5PEV	Discovery agent	N.A.	Investigative	[65]
ANTIOQUINE	DMUESP8	Discovery agent	N.A.	Investigative	[65]
Benzyl-(2-phenyl-quinazolin-4-yl)-amine	DM3X50C	Discovery agent	N.A.	Investigative	[31]
Beta-methoxyamphetamine	DMA9CSG	Discovery agent	N.A.	Investigative	[66]
Bip-tyr(3bzl)-thr-pro-lys-thr	DM4FSXK	Discovery agent	N.A.	Investigative	[67]
Bip-tyr-ala-pro-lys-thr(obzl)-gly	DM0VKA2	Discovery agent	N.A.	Investigative	[67]
Bip-tyr-thr-ala-pro-phe	DMUWE81	Discovery agent	N.A.	Investigative	[67]
Bip-tyr-thr-pro-ala-thr(obzl)-gly	DMN38JC	Discovery agent	N.A.	Investigative	[67]
Bip-tyr-thr-pro-lys-thr	DM7EKH3	Discovery agent	N.A.	Investigative	[67]
Bip-tyr-thr-pro-lys-thr(obzl)-gly	DMAPX9G	Discovery agent	N.A.	Investigative	[67]
Bip-tyr-thr-pro-thr(obzl)-gly	DM4CZ5B	Discovery agent	N.A.	Investigative	[67]
Biphenyl-2-ylmethyl-(S)-pyrrolidin-3-yl-amine	DM4D7V6	Discovery agent	N.A.	Investigative	[68]
Cis-3-phenoxy-2,3-dihydro-1H-inden-1-amine	DMTH4BG	Discovery agent	N.A.	Investigative	[69]
COCAINE.HCL	DMJRSIF	Discovery agent	N.A.	Investigative	[4]
COCLAURINE	DMZ1VSI	Discovery agent	N.A.	Investigative	[65]
D-166A	DMQJD4P	Discovery agent	N.A.	Investigative	[70]
D-211A	DMIBOAK	Discovery agent	N.A.	Investigative	[70]
D-211B	DM54CKZ	Discovery agent	N.A.	Investigative	[70]
D-254C	DM6KFCO	Discovery agent	N.A.	Investigative	[70]
D-257A	DMN7E6Y	Discovery agent	N.A.	Investigative	[70]
D-257C	DM5GLJ2	Discovery agent	N.A.	Investigative	[70]
Difluorobenztropine	DM8ABD6	Discovery agent	N.A.	Investigative	[60]
DIMETHYLGRISABINE	DMW0MTV	Discovery agent	N.A.	Investigative	[65]
Erythro-3,4-dichloromethylphenidate hydrochloride	DM8UVI3	Discovery agent	N.A.	Investigative	[4]
GB-12819	DM7B5HA	Discovery agent	N.A.	Investigative	[71]
HOMOAROMOLINE	DMIHFQY	Discovery agent	N.A.	Investigative	[65]
Indatraline	DMIP9DN	Discovery agent	N.A.	Investigative	[72]
ISOPILINE	DM9ERD6	Discovery agent	N.A.	Investigative	[65]
ISOTETRANDRINE	DM21K0E	Discovery agent	N.A.	Investigative	[65]
Methyl 2-(naphthalen-2-yl)benzoate	DMF6MRS	Discovery agent	N.A.	Investigative	[73]
Methylenedioxyamphetamine	DMP204G	Discovery agent	N.A.	Investigative	[74]
Methylenedioxymethamphetamine	DMYVU47	Discovery agent	N.A.	Investigative	[75], [57]
MMDA	DMUWVGP	Discovery agent	N.A.	Investigative	[76]
N,Ndimethyl milnacipran	DMTWK7L	Discovery agent	N.A.	Investigative	[77]
N-Benzylmethylphenidate	DMDZ5XI	Discovery agent	N.A.	Investigative	[30]
Nisoxetine	DMZBNH0	Discovery agent	N.A.	Investigative	[69]
NORBOLDINE	DM6BNQR	Discovery agent	N.A.	Investigative	[65]
NORSTEPHALAGINE	DM1VIHC	Discovery agent	N.A.	Investigative	[65]
O-2442	DMK8AGF	Cocaine addiction	6C45.2	Investigative	[9]
O-methyldauricine	DMKTA5R	Discovery agent	N.A.	Investigative	[65]
OBABERINE	DMY4PMN	Discovery agent	N.A.	Investigative	[65]
Para-chloroamphetamine	DMOH75D	Discovery agent	N.A.	Investigative	[57]
PF-18298	DMJMU09	Discovery agent	N.A.	Investigative	[36]
PF-3409409	DMEZA0T	Attention deficit hyperactivity disorder	6A05.Z	Investigative	[78]
PF-526014	DMD8QOZ	Discovery agent	N.A.	Investigative	[36]
PMID25037917C58	DMJPR8M	Discovery agent	N.A.	Investigative	[79]
PSEUDOCOCAINE	DMN5AE8	Discovery agent	N.A.	Investigative	[80]
Pyrovalerone	DMV48S2	Discovery agent	N.A.	Investigative	[50]
R-226161	DM4BP7S	Discovery agent	N.A.	Investigative	[81]
R-norduloxetine	DMGV4DS	Discovery agent	N.A.	Investigative	[82]
RTI-219	DM2QYXN	Discovery agent	N.A.	Investigative	[83]
SECOCULARIDINE	DM76CUP	Discovery agent	N.A.	Investigative	[65]
Threo-1-aza-5-phenyl[4.4.0]decane hydrochloride	DM4W1E8	Discovery agent	N.A.	Investigative	[4]
Threo-3,4-dichlororitalinol hydrochloride	DMA7GTH	N. A.	N. A.	Investigative	[4]
Threo-N-ethylritalinol hydrochloride	DMEVT7S	N. A.	N. A.	Investigative	[4]
Threo-ritalinol hydrochloride	DM4MPVE	N. A.	N. A.	Investigative	[4]
Threo-ritalinol methyl ether hydrochloride	DMV0CZ5	N. A.	N. A.	Investigative	[4]
Trans-3-(o-tolyloxy)-2,3-dihydro-1H-inden-1-amine	DMEDC5I	Discovery agent	N.A.	Investigative	[69]
WIN-35065	DM6IH4F	Discovery agent	N.A.	Investigative	[83]
WIN-35066-2	DMOX1S0	N. A.	N. A.	Investigative	[84]
[3-(3,4-Dichloro-phenyl)-indan-1-yl]-methyl-amine	DM4BYEQ	Discovery agent	N.A.	Investigative	[48]
[3H]GBR12935	DMGQDLU	Discovery agent	N.A.	Investigative	[85]
[3H]WIN35428	DMI8RU0	Discovery agent	N.A.	Investigative	[85], [86]
[N-[2-[(3'-N'-PROPYL-3''ALPHA-(BIS(4-FLUORORPHENYL)METHOXY)TROPANE-2''BETA-CARBOXYLIC ACID METHYL ESTER)(2-MERCAPTOETHYL)AMINO]ACETYL]-2-AMINOETHANETHIOLATO]RHENIUM(V) OXIDE (DIASTEREOMERIC MIX)	DMW9AST	Discovery agent	N.A.	Investigative	[87]
------------------------------------------------------------------------------------


⏷ Show the Full List of 252 Investigative Drug(s)

References

1	Rapid detection of Parkinson's disease by SPECT with altropane: a selective ligand for dopamine transporters. Synapse. 1998 Jun;29(2):128-41.
2	Differential involvement of the norepinephrine, serotonin and dopamine reuptake transporter proteins in cocaine-induced taste aversion. Pharmacol Biochem Behav. 2009 Jul;93(1):75-81.
3	Dasotraline for the Treatment of Attention-Deficit/Hyperactivity Disorder: A Randomized, Double-Blind, Placebo-Controlled, Proof-of-Concept Trial in Adults. Neuropsychopharmacology. 2015 Nov;40(12):2745-52.
4	Synthesis and pharmacology of site-specific cocaine abuse treatment agents: restricted rotation analogues of methylphenidate. J Med Chem. 2007 May 31;50(11):2718-31.
5	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
6	Imaging the effects of methylphenidate on brain dopamine: new model on its therapeutic actions for attention-deficit/hyperactivity disorder. Biol Psychiatry. 2005 Jun 1;57(11):1410-5.
7	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services.
8	Interaction of the anorectic medication, phendimetrazine, and its metabolites with monoamine transporters in rat brain. Eur J Pharmacol. 2002 Jun 28;447(1):51-7.
9	URL: http://www.guidetopharmacology.org Nucleic Acids Res. 2015 Oct 12. pii: gkv1037. The IUPHAR/BPS Guide to PHARMACOLOGY in 2016: towards curated quantitative interactions between 1300 protein targets and 6000 ligands. (Target id: 927).
10	Anti-obesity drugs. Expert Opin Pharmacother. 2008 Jun;9(8):1339-50.
11	Clinical pipeline report, company report or official report of the Pharmaceutical Research and Manufacturers of America (PhRMA)
12	Novel drugs and therapeutic targets for severe mood disorders. Neuropsychopharmacology. 2008 Aug;33(9):2080-92.
13	Emerging drugs for attention-deficit/hyperactivity disorder. Expert Opin Emerg Drugs. 2007 Sep;12(3):423-34.
14	Emerging drugs in neuropathic pain. Expert Opin Emerg Drugs. 2007 Mar;12(1):113-26.
15	Monoamine transporter occupancy of a novel triple reuptake inhibitor in baboons and humans using positron emission tomography. J Pharmacol Exp Ther. 2013 Aug;346(2):311-7.
16	Development of the dopamine transporter selective RTI-336 as a pharmacotherapy for cocaine abuse.AAPS J.2006 Mar 24;8(1):E196-203.
17	Amineptine in the treatment of amphetamine withdrawal: a placebo-controlled, randomised, double-blind study. J Med Assoc Thai. 1997 Sep;80(9):587-92.
18	Pharmacogenetics and obesity: common gene variants influence weight loss response of the norepinephrine/dopamine transporter inhibitor GW320659 in obese subjects. Pharmacogenet Genomics. 2005 Dec;15(12):883-9.
19	Clinical pipeline report, company report or official report of Neurosearch.
20	Emerging drugs for bipolar disorder. Expert Opin Emerg Drugs. 2006 Nov;11(4):621-34.
21	Emerging drugs for obesity: linking novel biological mechanisms to pharmaceutical pipelines. Expert Opin Emerg Drugs. 2005 Aug;10(3):643-60.
22	Dopamine uptake inhibitor-induced rotation in 6-hydroxydopamine-lesioned rats involves both D1 and D2 receptors but is modulated through 5-hydroxyt... J Pharmacol Exp Ther. 2005 Mar;312(3):1124-31.
23	Treating Attention-Deficit/Hyperactivity Disorder in Adults: Focus on Once-Daily Medications. Prim Care Companion CNS Disord 2011.
24	NSD-644: Phase I started.NeuroSearch A/S (CSE:NEUR), Ballerup, Denmark, GlaxoSmithKline plc (LSE:GSK; GSK), London, U.K.
25	Trusted, scientifically sound profiles of drug programs, clinical trials, safety reports, and company deals, written by scientists. Springer. 2015. Adis Insight (drug id 800031598)
26	Emerging pharmacological strategies in the fight against cocaine addiction. Expert Opin Emerg Drugs. 2006 Mar;11(1):91-8.
27	Technepine: a high-affinity 99m-technetium probe to label the dopamine transporter in brain by SPECT imaging. Synapse. 1996 Mar;22(3):239-46.
28	Pridopidine selectively occupies sigma-1 rather than dopamine D2 receptors at behaviorally active doses. Psychopharmacology (Berl). 2015 Sep;232(18):3443-53.
29	Design and optimization of selective serotonin re-uptake inhibitors with high synthetic accessibility. Part 1. Bioorg Med Chem Lett. 2009 Apr 15;19(8):2329-32.
30	Quantitative structure-activity relationship studies of threo-methylphenidate analogs. Bioorg Med Chem. 2010 Oct 15;18(20):7221-38.
31	Identification of a novel partial inhibitor of dopamine transporter among 4-substituted 2-phenylquinazolines. Bioorg Med Chem Lett. 2002 Aug 19;12(16):2225-8.
32	New iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2008 Sep 15;18(18):4940-3.
33	Design and synthesis of (2R,3S)-iodoreboxetine analogues for SPECT imaging of the noradrenaline transporter. Bioorg Med Chem Lett. 2009 Sep 1;19(17):4996-8.
34	Synthesis and characterization of in vitro and in vivo profiles of hydroxybupropion analogues: aids to smoking cessation. J Med Chem. 2010 Jun 24;53(12):4731-48.
35	Studies on the structure-activity relationship of bicifadine analogs as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Jul 1;18(13):3682-6.
36	Second generation N-(1,2-diphenylethyl)piperazines as dual serotonin and noradrenaline reuptake inhibitors: improving metabolic stability and reduc... Bioorg Med Chem Lett. 2010 Jun 15;20(12):3788-92.
37	1-Naphthyl and 4-indolyl arylalkylamines as selective monoamine reuptake inhibitors. Bioorg Med Chem Lett. 2009 Jan 1;19(1):58-61.
38	Bioorg Med Chem Lett. 2009 Oct 15;19(20):5893-7. Epub 2009 Aug 21.Design and optimisation of selective serotonin re-uptake inhibitors with high synthetic accessibility: part 2.
39	Stereoselective inhibition of serotonin re-uptake and phosphodiesterase by dual inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Jan 1;17(1):337-43.
40	Slow-onset, long-duration, alkyl analogues of methylphenidate with enhanced selectivity for the dopamine transporter. J Med Chem. 2007 Jan 25;50(2):219-32.
41	Structure-activity relationships of N-substituted piperazine amine reuptake inhibitors. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4349-53.
42	Identification of a potent, selective, and orally active leukotriene a4 hydrolase inhibitor with anti-inflammatory activity. J Med Chem. 2008 Jul 24;51(14):4150-69.
43	Synthesis and biological evaluation of 1-[1-(2-benzo[b]thienyl)cyclohexyl]piperidine homologues at dopamine-uptake and phencyclidine- and sigma-bin... J Med Chem. 1993 Apr 30;36(9):1188-93.
44	Selective monoamine oxidase inhibitors. 3. Cyclic compounds related to 4-aminophenethylamine. Preparation and neuron-selective action of some 5-(2-... J Med Chem. 1986 Aug;29(8):1406-12.
45	N-(1,2-diphenylethyl)piperazines: a new class of dual serotonin/noradrenaline reuptake inhibitor. Bioorg Med Chem Lett. 2006 Aug 15;16(16):4345-8.
46	Discovery and pharmacological characterization of aryl piperazine and piperidine ethers as dual acting norepinephrine reuptake inhibitors and 5-HT1... Bioorg Med Chem Lett. 2009 Dec 1;19(23):6604-7.
47	1-(4-Methylphenyl)-2-pyrrolidin-1-yl-pentan-1-one (Pyrovalerone) analogues: a promising class of monoamine uptake inhibitors. J Med Chem. 2006 Feb 23;49(4):1420-32.
48	Synthesis and pharmacological evaluation of 3-(3,4-dichlorophenyl)-1-indanamine derivatives as nonselective ligands for biogenic amine transporters. J Med Chem. 2004 May 6;47(10):2624-34.
49	Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for smoking cessation. J Med Chem. 2010 Mar 11;53(5):2204-14.
50	A novel photoaffinity ligand for the dopamine transporter based on pyrovalerone. Bioorg Med Chem. 2009 Jun 1;17(11):3770-4.
51	Des-keto lobeline analogs with increased potency and selectivity at dopamine and serotonin transporters. Bioorg Med Chem Lett. 2006 Oct 1;16(19):5018-21.
52	Characterization of thien-2-yl 1S,2R-milnacipran analogues as potent norepinephrine/serotonin transporter inhibitors for the treatment of neuropath... J Med Chem. 2008 Nov 27;51(22):7265-72.
53	Development of SPECT imaging agents for the norepinephrine transporters: [123I]INER. Bioorg Med Chem Lett. 2007 Jan 15;17(2):533-7.
54	2,5-Disubstituted tetrahydrofurans as selective serotonin re-uptake inhibitors. Bioorg Med Chem. 2009 Mar 1;17(5):2047-68.
55	Design, synthesis, and pharmacological evaluation of phenoxy pyridyl derivatives as dual norepinephrine reuptake inhibitors and 5-HT1A partial agon... Bioorg Med Chem Lett. 2010 Feb 1;20(3):1114-7.
56	Synthesis and biological evaluation of bupropion analogues as potential pharmacotherapies for cocaine addiction. J Med Chem. 2009 Nov 12;52(21):6768-81.
57	Synthesis and serotonin transporter activity of sulphur-substituted alpha-alkyl phenethylamines as a new class of anticancer agents. Eur J Med Chem. 2009 Dec;44(12):4862-88.
58	Synthesis and monoamine transporter affinity of 3alpha-arylmethoxy-3beta-arylnortropanes. Bioorg Med Chem Lett. 2009 Dec 15;19(24):6865-8.
59	3alpha-(4-Substituted phenyl)nortropane-2beta-carboxylic acid methyl esters show selective binding at the norepinephrine transporter. Bioorg Med Chem Lett. 2000 Nov 6;10(21):2445-7.
60	Structure-activity relationship studies on a novel series of (S)-2beta-substituted 3alpha-[bis(4-fluoro- or 4-chlorophenyl)methoxy]tropane analogue... J Med Chem. 2006 Oct 19;49(21):6391-9.
61	Conformationally restricted homotryptamines 3. Indole tetrahydropyridines and cyclohexenylamines as selective serotonin reuptake inhibitors. Bioorg Med Chem Lett. 2007 Jun 1;17(11):3099-104.
62	Discovery of N-{1-[3-(3-oxo-2,3-dihydrobenzo[1,4]oxazin-4-yl)propyl]piperidin-4-yl}-2-phenylacetamide (Lu AE51090): an allosteric muscarinic M1 rec... J Med Chem. 2010 Sep 9;53(17):6386-97.
63	Lobeline esters as novel ligands for neuronal nicotinic acetylcholine receptors and neurotransmitter transporters. Bioorg Med Chem. 2010 Jan 15;18(2):640-9.
64	3'-Chloro-3 alpha-(diphenylmethoxy)tropane but not 4'-chloro-3 alpha-(diphenylmethoxy)tropane produces a cocaine-like behavioral profile. J Med Chem. 1997 Mar 14;40(6):851-7.
65	Effects of various isoquinoline alkaloids on in vitro 3H-dopamine uptake by rat striatal synaptosomes. J Nat Prod. 1995 Oct;58(10):1475-84.
66	Differential behavioural and neurochemical effects of para-methoxyamphetamine and 3,4-methylenedioxymethamphetamine in the rat. Prog Neuropsychopharmacol Biol Psychiatry. 2000 Aug;24(6):955-77.
67	Development of peptidic dopamine transporter inhibitors via aromatic modification-mediated conformational restriction. J Med Chem. 2006 Jul 13;49(14):4048-51.
68	Derivatives of (3S)-N-(biphenyl-2-ylmethyl)pyrrolidin-3-amine as selective noradrenaline reuptake inhibitors: Reducing P-gp mediated efflux by modu... Bioorg Med Chem Lett. 2008 Aug 1;18(15):4355-9.
69	Discovery of a potent, selective, and less flexible selective norepinephrine reuptake inhibitor (sNRI). Bioorg Med Chem Lett. 2008 Jul 15;18(14):4224-7.
70	Further structural optimization of cis-(6-benzhydryl-piperidin-3-yl)-benzylamine and 1,4-diazabicyclo[3.3.1]nonane derivatives by introducing an ex... Bioorg Med Chem. 2008 Mar 15;16(6):2769-78.
71	Synthesis and dopamine transporter binding affinities of 3alpha-benzyl-8-(diarylmethoxyethyl)-8-azabicyclo[3.2.1]octanes. Bioorg Med Chem Lett. 2002 Sep 2;12(17):2387-90.
72	Effects of indatraline and buprenorphine on self-administration of speedball combinations of cocaine and heroin by rhesus monkeys. Neuropsychopharmacology. 2001 Jul;25(1):104-17.
73	Synthesis, inhibition and binding of simple non-nitrogen inhibitors of monoamine transporters. Bioorg Med Chem. 2007 Jun 15;15(12):4159-74.
74	Synthesis and in vitro toxicity of 4-MTA, its characteristic clandestine synthesis byproducts and related sulfur substituted alpha-alkylthioampheta... Bioorg Med Chem. 2010 Jun 1;18(11):4009-31.
75	The origin of MDMA (ecstasy) revisited: the true story reconstructed from the original documents. Addiction. 2006 Sep;101(9):1241-5.
76	How many drug targets are there Nat Rev Drug Discov. 2006 Dec;5(12):993-6.
77	Studies on the SAR and pharmacophore of milnacipran derivatives as monoamine transporter inhibitors. Bioorg Med Chem Lett. 2008 Feb 15;18(4):1346-9.
78	Design, synthesis and evaluation of N-[(3S)-pyrrolidin-3-yl]benzamides as selective noradrenaline reuptake inhibitors: CNS penetration in a more po... Bioorg Med Chem Lett. 2009 Aug 15;19(16):4579-83.
79	Novel inhibitors of the high-affinity L-proline transporter as potential therapeutic agents for the treatment of cognitive disorders. Bioorg Med Chem Lett. 2014 Aug 15;24(16):3886-90.
80	Synthesis of 8-Oxa analogues of norcocaine endowed with interesting cocaine-like activity. Bioorg Med Chem Lett. 1999 Jul 5;9(13):1831-6.
81	Tricyclic isoxazolines: identification of R226161 as a potential new antidepressant that combines potent serotonin reuptake inhibition and alpha2-a... Bioorg Med Chem. 2007 Jun 1;15(11):3649-60.
82	Inhibition of serotonin and norepinephrine reuptake and inhibition of phosphodiesterase by multi-target inhibitors as potential agents for depression. Bioorg Med Chem. 2009 Oct 1;17(19):6890-7.
83	Synthesis, monoamine transporter binding, properties, and functional monoamine uptake activity of 3beta-[4-methylphenyl and 4-chlorophenyl]-2 beta-... J Med Chem. 2007 Jul 26;50(15):3686-95.
84	Monoamine transporter binding, locomotor activity, and drug discrimination properties of 3-(4-substituted-phenyl)tropane-2-carboxylic acid methyl e... J Med Chem. 2004 Dec 2;47(25):6401-9.
85	Pharmacological heterogeneity of the cloned and native human dopamine transporter: disassociation of [3H]WIN 35,428 and [3H]GBR 12,935 binding. Mol Pharmacol. 1994 Jan;45(1):125-35.
86	3 alpha-(4'-substituted phenyl)tropane-2 beta-carboxylic acid methyl esters: novel ligands with high affinity and selectivity at the dopamine trans... J Med Chem. 1996 Oct 11;39(21):4139-41.
87	A technetium-99m SPECT imaging agent which targets the dopamine transporter in primate brain. J Med Chem. 1997 Jun 6;40(12):1835-44.
88	Amphetamines, new psychoactive drugs and the monoamine transporter cycle. Trends Pharmacol Sci. 2015 Jan;36(1):41-50.
89	Pharmacological characterization of a dopamine transporter ligand that functions as a cocaine antagonist. J Pharmacol Exp Ther. 2014 Jan;348(1):106-15.
90	Which form of dopamine is the substrate for the human dopamine transporter: the cationic or the uncharged species? J Biol Chem. 1999 Feb 19;274(8):4876-82.
91	Characterization of VNTRs Within the Entire Region of SLC6A3 and Its Association with Hypertension. DNA Cell Biol. 2017 Mar;36(3):227-236.
92	Brexpiprazole reduces hyperactivity, impulsivity, and risk-preference behavior in mice with dopamine transporter knockdown-a model of mania. Psychopharmacology (Berl). 2017 Mar;234(6):1017-1028.