General Information of Drug Off-Target (DOT) (ID: OT18H5HD)

DOT Name Guanine nucleotide exchange factor for Rab-3A (RAB3IL1)
Synonyms Rab-3A-interacting-like protein 1; Rab3A-interacting-like protein 1; Rabin3-like 1
Gene Name RAB3IL1
Related Disease
Bacteremia ( )
Streptococcal toxic-shock syndrome ( )
UniProt ID
R3GEF_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
4LI0
Pfam ID
PF06428
Sequence
MWSGPPQPDQGLPPPLAAVPVPWKSTDPCQGHRESPGALVETSAGEEAQGQEGPAAAQLD
VLRLRSSSMEIREKGSEFLKEELHRAQKELKLKDEECERLSKVREQLEQELEELTASLFE
EAHKMVREANMKQAASEKQLKEARGKIDMLQAEVTALKTLVITSTPASPNRELHPQLLSP
TKAGPRKGHSRHKSTSSTLCPAVCPAAGHTLTPDREGKEVDTILFAEFQAWRESPTLDKT
CPFLERVYREDVGPCLDFTMQELSVLVRAAVEDNTLTIEPVASQTLPTVKVAEVDCSSTN
TCALSGLTRTCRHRIRLGDSKSHYYISPSSRARITAVCNFFTYIRYIQQGLVRQDAEPMF
WEIMRLRKEMSLAKLGFFPQEA
Function
Guanine nucleotide exchange factor (GEF) which may activate RAB3A, a GTPase that regulates synaptic vesicle exocytosis. Promotes the exchange of GDP to GTP, converting inactive GDP-bound Rab proteins into their active GTP-bound form. May also activate RAB8A and RAB8B.
Reactome Pathway
RAB GEFs exchange GTP for GDP on RABs (R-HSA-8876198 )

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bacteremia DIS6N9RZ Definitive Altered Expression [1]
Streptococcal toxic-shock syndrome DISCVXCW Definitive Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
NAPQI DM8F5LR Investigative Guanine nucleotide exchange factor for Rab-3A (RAB3IL1) affects the response to substance of NAPQI. [15]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [2]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [14]
------------------------------------------------------------------------------------
11 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [3]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [4]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [5]
Temozolomide DMKECZD Approved Temozolomide decreases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [6]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [7]
Niclosamide DMJAGXQ Approved Niclosamide increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [9]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [10]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [11]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [12]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Guanine nucleotide exchange factor for Rab-3A (RAB3IL1). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 11 Drug(s)

References

1 Low antibody levels against cell wall-attached proteins of Streptococcus pyogenes predispose for severe invasive disease.J Infect Dis. 2004 Mar 1;189(5):797-804. doi: 10.1086/381982. Epub 2004 Feb 18.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
4 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
5 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
6 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
7 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
8 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
9 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
10 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
11 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12 Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
13 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
14 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
15 Acetaminophen-NAPQI hepatotoxicity: a cell line model system genome-wide association study. Toxicol Sci. 2011 Mar;120(1):33-41. doi: 10.1093/toxsci/kfq375. Epub 2010 Dec 22.