Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9UC5PE)

DOT Name Homeobox protein Hox-B3 (HOXB3)
Synonyms Homeobox protein Hox-2.7; Homeobox protein Hox-2G
Gene Name HOXB3
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Acute lymphocytic leukaemia ( )
Adult glioblastoma ( )
Advanced cancer ( )
Campomelic dysplasia ( )
Cardiovascular disease ( )
Dental caries ( )
Diabetic retinopathy ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Epithelial ovarian cancer ( )
Estrogen-receptor positive breast cancer ( )
Glioblastoma multiforme ( )
Glioma ( )
Motion sickness ( )
Neoplasm ( )
Neuroblastoma ( )
Obesity ( )
Ovarian cancer ( )
Renal carcinoma ( )
Renal cell carcinoma ( )
Acute myelogenous leukaemia ( )
Colon cancer ( )
Colon carcinoma ( )
Lung adenocarcinoma ( )
leukaemia ( )
Leukemia ( )
UniProt ID
HXB3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF13293 ; PF00046
Sequence
MQKATYYDNAAAALFGGYSSYPGSNGFGFDVPPQPPFQAATHLEGDYQRSACSLQSLGNA
APHAKSKELNGSCMRPGLAPEPLSAPPGSPPPSAAPTSATSNSSNGGGPSKSGPPKCGPG
TNSTLTKQIFPWMKESRQTSKLKNNSPGTAEGCGGGGGGGGGGGSGGSGGGGGGGGGGDK
SPPGSAASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRR
MKYKKDQKAKGLASSSGGPSPAGSPPQPMQSTAGFMNALHSMTPSYESPSPPAFGKAHQN
AYALPSNYQPPLKGCGAPQKYPPTPAPEYEPHVLQANGGAYGTPTMQGSPVYVGGGGYAD
PLPPPAGPSLYGLNHLSHHPSGNLDYNGAPPMAPSQHHGPCEPHPTYTDLSSHHAPPPQG
RIQEAPKLTHL
Function Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis.
Reactome Pathway
Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )

Molecular Interaction Atlas (MIA) of This DOT

28 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Definitive Biomarker [1]
Breast carcinoma DIS2UE88 Definitive Biomarker [1]
Acute lymphocytic leukaemia DISPX75S Strong Biomarker [2]
Adult glioblastoma DISVP4LU Strong Genetic Variation [3]
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Campomelic dysplasia DISVTW53 Strong Biomarker [4]
Cardiovascular disease DIS2IQDX Strong Genetic Variation [5]
Dental caries DISRBCMD Strong Genetic Variation [6]
Diabetic retinopathy DISHGUJM Strong Biomarker [7]
Endometrial cancer DISW0LMR Strong Altered Expression [8]
Endometrial carcinoma DISXR5CY Strong Altered Expression [8]
Epithelial ovarian cancer DIS56MH2 Strong Posttranslational Modification [9]
Estrogen-receptor positive breast cancer DIS1H502 Strong Biomarker [1]
Glioblastoma multiforme DISK8246 Strong Altered Expression [10]
Glioma DIS5RPEH Strong Biomarker [11]
Motion sickness DISZ2WZW Strong Genetic Variation [12]
Neoplasm DISZKGEW Strong Altered Expression [13]
Neuroblastoma DISVZBI4 Strong Altered Expression [3]
Obesity DIS47Y1K Strong Genetic Variation [14]
Ovarian cancer DISZJHAP Strong Altered Expression [15]
Renal carcinoma DISER9XT Strong Genetic Variation [16]
Renal cell carcinoma DISQZ2X8 Strong Genetic Variation [16]
Acute myelogenous leukaemia DISCSPTN moderate Altered Expression [13]
Colon cancer DISVC52G moderate Biomarker [17]
Colon carcinoma DISJYKUO moderate Biomarker [17]
Lung adenocarcinoma DISD51WR moderate Biomarker [18]
leukaemia DISS7D1V Limited Genetic Variation [19]
Leukemia DISNAKFL Limited Genetic Variation [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 28 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein Hox-B3 (HOXB3). [20]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Homeobox protein Hox-B3 (HOXB3). [21]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Homeobox protein Hox-B3 (HOXB3). [22]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Homeobox protein Hox-B3 (HOXB3). [24]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of Homeobox protein Hox-B3 (HOXB3). [25]
Fluorouracil DMUM7HZ Approved Fluorouracil decreases the expression of Homeobox protein Hox-B3 (HOXB3). [26]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Homeobox protein Hox-B3 (HOXB3). [28]
Nitrobenzanthrone DMN6L70 Investigative Nitrobenzanthrone increases the expression of Homeobox protein Hox-B3 (HOXB3). [29]
EPZ-004777 DMLN4V5 Investigative EPZ-004777 decreases the expression of Homeobox protein Hox-B3 (HOXB3). [30]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Homeobox protein Hox-B3 (HOXB3). [23]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Homeobox protein Hox-B3 (HOXB3). [27]
------------------------------------------------------------------------------------

References

1 miR-375 inhibits cancer stem cell phenotype and tamoxifen resistance by degrading HOXB3 in human ER-positive breast cancer.Oncol Rep. 2017 Feb;37(2):1093-1099. doi: 10.3892/or.2017.5360. Epub 2017 Jan 9.
2 Expression of selected human HOX-2 genes in B/T acute lymphoid leukemia and interleukin-2/interleukin-1 beta-stimulated natural killer lymphocytes.Blood. 1992 Jul 1;80(1):185-93.
3 Modulation of HOX2 gene expression following differentiation of neuronal cell lines.Differentiation. 1992 Sep;51(1):39-47. doi: 10.1111/j.1432-0436.1992.tb00678.x.
4 Assignment of an autosomal sex reversal locus (SRA1) and campomelic dysplasia (CMPD1) to 17q24.3-q25.1.Nat Genet. 1993 Jun;4(2):170-4. doi: 10.1038/ng0693-170.
5 Leveraging Polygenic Functional Enrichment to Improve GWAS Power.Am J Hum Genet. 2019 Jan 3;104(1):65-75. doi: 10.1016/j.ajhg.2018.11.008. Epub 2018 Dec 27.
6 Genome-wide analysis of dental caries and periodontitis combining clinical and self-reported data.Nat Commun. 2019 Jun 24;10(1):2773. doi: 10.1038/s41467-019-10630-1.
7 Effects of Morphine on Interstitial Cells of Cajal in Rabbit Colon and Small Intestinal Transit: An Experimental Study.Curr Mol Med. 2020;20(3):240-246. doi: 10.2174/1566524019666191023112837.
8 miR-10b Inhibits Apoptosis and Promotes Proliferation and Invasion of Endometrial Cancer Cells via Targeting HOXB3.Cancer Biother Radiopharm. 2016 Aug;31(6):225-31. doi: 10.1089/cbr.2016.1998.
9 Genetic Data from Nearly 63,000 Women of European Descent Predicts DNA Methylation Biomarkers and Epithelial Ovarian Cancer Risk.Cancer Res. 2019 Feb 1;79(3):505-517. doi: 10.1158/0008-5472.CAN-18-2726. Epub 2018 Dec 17.
10 Homeobox B3 promotes tumor cell proliferation and invasion in glioblastoma.Oncol Lett. 2018 Mar;15(3):3712-3718. doi: 10.3892/ol.2018.7750. Epub 2018 Jan 8.
11 MicroRNA-10b-5p downregulation inhibits the invasion of glioma cells via modulating homeobox B3 expression.Exp Ther Med. 2019 Jun;17(6):4577-4585. doi: 10.3892/etm.2019.7506. Epub 2019 Apr 19.
12 Genetic variants associated with motion sickness point to roles for inner ear development, neurological processes and glucose homeostasis.Hum Mol Genet. 2015 May 1;24(9):2700-8. doi: 10.1093/hmg/ddv028. Epub 2015 Jan 26.
13 A novel miR-375-HOXB3-CDCA3/DNMT3B regulatory circuitry contributes to leukemogenesis in acute myeloid leukemia.BMC Cancer. 2018 Feb 13;18(1):182. doi: 10.1186/s12885-018-4097-z.
14 A genome-wide association meta-analysis identifies new childhood obesity loci.Nat Genet. 2012 May;44(5):526-31. doi: 10.1038/ng.2247.
15 HOXA4/HOXB3 gene expression signature as a biomarker of recurrence in patients with high-grade serous ovarian cancer following primary cytoreductive surgery and first-line adjuvant chemotherapy.Gynecol Oncol. 2018 Apr;149(1):155-162. doi: 10.1016/j.ygyno.2018.01.022.
16 HOX gene expression in normal and neoplastic human kidney.Int J Cancer. 1992 Jul 30;51(6):892-7. doi: 10.1002/ijc.2910510610.
17 LncRNA-UCA1 modulates progression of colon cancer through regulating the miR-28-5p/HOXB3 axis.J Cell Biochem. 2019 May;120(5):6926-6936. doi: 10.1002/jcb.27630. Epub 2019 Jan 16.
18 Identification and validation of candidate epigenetic biomarkers in lung adenocarcinoma.Sci Rep. 2016 Oct 26;6:35807. doi: 10.1038/srep35807.
19 FLT3 internal tandem duplication associates with adverse outcome and gene- and microRNA-expression signatures in patients 60 years of age or older with primary cytogenetically normal acute myeloid leukemia: a Cancer and Leukemia Group B study.Blood. 2010 Nov 4;116(18):3622-6. doi: 10.1182/blood-2010-05-283648. Epub 2010 Jul 23.
20 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
21 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
22 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
23 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
24 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
25 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
26 Evaluation of developmental toxicity using undifferentiated human embryonic stem cells. J Appl Toxicol. 2015 Feb;35(2):205-18.
27 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
28 Cultured human peripheral blood mononuclear cells alter their gene expression when challenged with endocrine-disrupting chemicals. Toxicology. 2013 Jan 7;303:17-24.
29 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
30 DOT1L as a therapeutic target for the treatment of DNMT3A-mutant acute myeloid leukemia. Blood. 2016 Aug 18;128(7):971-81. doi: 10.1182/blood-2015-11-684225. Epub 2016 Jun 22.