Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTB6GQ09)

DOT Name Homeobox protein Hox-A10 (HOXA10)
Synonyms Homeobox protein Hox-1.8; Homeobox protein Hox-1H; PL
Gene Name HOXA10
Related Disease
Adult glioblastoma ( )
Advanced cancer ( )
Glioblastoma multiforme ( )
Ovarian cancer ( )
Adenocarcinoma ( )
Colorectal carcinoma ( )
Endometrium adenocarcinoma ( )
Endometrium neoplasm ( )
Epithelial ovarian cancer ( )
Glioma ( )
Hepatocellular carcinoma ( )
Leiomyoma ( )
Lung adenocarcinoma ( )
Myeloproliferative neoplasm ( )
Neoplasm ( )
Non-small-cell lung cancer ( )
Oral cancer ( )
Ovarian neoplasm ( )
Polycystic ovarian syndrome ( )
Prostate neoplasm ( )
T-cell acute lymphoblastic leukaemia ( )
Bladder cancer ( )
Breast cancer ( )
Breast carcinoma ( )
Chronic obstructive pulmonary disease ( )
Gastric cancer ( )
Head-neck squamous cell carcinoma ( )
leukaemia ( )
Squamous cell carcinoma ( )
Stomach cancer ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Carcinoma ( )
Acute myelogenous leukaemia ( )
Endometrial cancer ( )
Endometrial carcinoma ( )
Gonorrhea ( )
Leukemia ( )
Liver cancer ( )
Prostate cancer ( )
Prostate carcinoma ( )
Uterine fibroids ( )
UniProt ID
HXA10_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MSARKGYLLPSPNYPTTMSCSESPAANSFLVDSLISSGRGEAGGGGGGAGGGGGGGYYAH
GGVYLPPAADLPYGLQSCGLFPTLGGKRNEAASPGSGGGGGGLGPGAHGYGPSPIDLWLD
APRSCRMEPPDGPPPPPQQQPPPPPQPPQPAPQATSCSFAQNIKEESSYCLYDSADKCPK
VSATAAELAPFPRGPPPDGCALGTSSGVPVPGYFRLSQAYGTAKGYGSGGGGAQQLGAGP
FPAQPPGRGFDLPPALASGSADAARKERALDSPPPPTLACGSGGGSQGDEEAHASSSAAE
ELSPAPSESSKASPEKDSLGNSKGENAANWLTAKSGRKKRCPYTKHQTLELEKEFLFNMY
LTRERRLEISRSVHLTDRQVKIWFQNRRMKLKKMNRENRIRELTANFNFS
Function
Sequence-specific transcription factor which is part of a developmental regulatory system that provides cells with specific positional identities on the anterior-posterior axis. Binds to the DNA sequence 5'-AA[AT]TTTTATTAC-3'.
KEGG Pathway
Transcriptio.l misregulation in cancer (hsa05202 )

Molecular Interaction Atlas (MIA) of This DOT

42 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult glioblastoma DISVP4LU Definitive Posttranslational Modification [1]
Advanced cancer DISAT1Z9 Definitive Altered Expression [2]
Glioblastoma multiforme DISK8246 Definitive Posttranslational Modification [1]
Ovarian cancer DISZJHAP Definitive Biomarker [3]
Adenocarcinoma DIS3IHTY Strong Biomarker [4]
Colorectal carcinoma DIS5PYL0 Strong Altered Expression [5]
Endometrium adenocarcinoma DISY6744 Strong Altered Expression [6]
Endometrium neoplasm DIS6OS2L Strong Biomarker [7]
Epithelial ovarian cancer DIS56MH2 Strong Biomarker [3]
Glioma DIS5RPEH Strong Biomarker [8]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [9]
Leiomyoma DISLDDFN Strong Altered Expression [10]
Lung adenocarcinoma DISD51WR Strong Biomarker [11]
Myeloproliferative neoplasm DIS5KAPA Strong Altered Expression [12]
Neoplasm DISZKGEW Strong Biomarker [13]
Non-small-cell lung cancer DIS5Y6R9 Strong Altered Expression [14]
Oral cancer DISLD42D Strong Biomarker [15]
Ovarian neoplasm DISEAFTY Strong Biomarker [3]
Polycystic ovarian syndrome DISZ2BNG Strong Altered Expression [16]
Prostate neoplasm DISHDKGQ Strong Altered Expression [13]
T-cell acute lymphoblastic leukaemia DIS17AI2 Strong Genetic Variation [17]
Bladder cancer DISUHNM0 moderate Altered Expression [18]
Breast cancer DIS7DPX1 moderate Genetic Variation [19]
Breast carcinoma DIS2UE88 moderate Genetic Variation [19]
Chronic obstructive pulmonary disease DISQCIRF moderate Genetic Variation [20]
Gastric cancer DISXGOUK moderate Biomarker [21]
Head-neck squamous cell carcinoma DISF7P24 moderate Altered Expression [22]
leukaemia DISS7D1V moderate Altered Expression [23]
Squamous cell carcinoma DISQVIFL moderate Posttranslational Modification [24]
Stomach cancer DISKIJSX moderate Biomarker [21]
Urinary bladder cancer DISDV4T7 moderate Altered Expression [18]
Urinary bladder neoplasm DIS7HACE moderate Altered Expression [18]
Carcinoma DISH9F1N Disputed Altered Expression [7]
Acute myelogenous leukaemia DISCSPTN Limited Altered Expression [23]
Endometrial cancer DISW0LMR Limited Altered Expression [25]
Endometrial carcinoma DISXR5CY Limited Altered Expression [25]
Gonorrhea DISQ5AO6 Limited Biomarker [26]
Leukemia DISNAKFL Limited Biomarker [27]
Liver cancer DISDE4BI Limited Altered Expression [28]
Prostate cancer DISF190Y Limited Biomarker [13]
Prostate carcinoma DISMJPLE Limited Biomarker [13]
Uterine fibroids DISBZRMJ Limited Altered Expression [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 42 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
3 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Homeobox protein Hox-A10 (HOXA10). [29]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Homeobox protein Hox-A10 (HOXA10). [35]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Homeobox protein Hox-A10 (HOXA10). [38]
------------------------------------------------------------------------------------
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Homeobox protein Hox-A10 (HOXA10). [30]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of Homeobox protein Hox-A10 (HOXA10). [31]
Estradiol DMUNTE3 Approved Estradiol increases the expression of Homeobox protein Hox-A10 (HOXA10). [32]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Homeobox protein Hox-A10 (HOXA10). [33]
Progesterone DMUY35B Approved Progesterone decreases the expression of Homeobox protein Hox-A10 (HOXA10). [34]
Diethylstilbestrol DMN3UXQ Approved Diethylstilbestrol increases the expression of Homeobox protein Hox-A10 (HOXA10). [32]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Homeobox protein Hox-A10 (HOXA10). [33]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Homeobox protein Hox-A10 (HOXA10). [36]
THAPSIGARGIN DMDMQIE Preclinical THAPSIGARGIN decreases the expression of Homeobox protein Hox-A10 (HOXA10). [37]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)

References

1 Chromosome 7 gain and DNA hypermethylation at the HOXA10 locus are associated with expression of a stem cell related HOX-signature in glioblastoma.Genome Biol. 2015 Jan 27;16(1):16. doi: 10.1186/s13059-015-0583-7.
2 miR-494 represses HOXA10 expression and inhibits cell proliferation in oral cancer.Oral Oncol. 2015 Feb;51(2):151-7. doi: 10.1016/j.oraloncology.2014.11.019. Epub 2014 Dec 12.
3 Activation of ARK5/miR-1181/HOXA10 axis promotes epithelial-mesenchymal transition in ovarian cancer.Oncol Rep. 2015 Sep;34(3):1193-202. doi: 10.3892/or.2015.4113. Epub 2015 Jul 7.
4 DNA methylation profile during multistage progression of pulmonary adenocarcinomas.Virchows Arch. 2011 Aug;459(2):201-11. doi: 10.1007/s00428-011-1079-9. Epub 2011 Apr 15.
5 Upregulation of HOXA10 Protein Expression Predicts Poor Prognosis for Colorectal Cancer.Genet Test Mol Biomarkers. 2018 Jun;22(6):390-397. doi: 10.1089/gtmb.2017.0240. Epub 2018 Jun 5.
6 HOXA10 expression in endometrial adenocarcinoma.Tumour Biol. 2004 Sep-Dec;25(5-6):264-9. doi: 10.1159/000081390.
7 Expression of HOXA10 in endometrial hyperplasia and adenocarcinoma and regulation by sex hormones in vitro.Int J Gynecol Cancer. 2011 Jul;21(5):800-5. doi: 10.1097/IGC.0b013e31821a2584.
8 HOXA10AS: A novel oncogenic long noncoding RNA in glioma.Oncol Rep. 2018 Nov;40(5):2573-2583. doi: 10.3892/or.2018.6662. Epub 2018 Aug 21.
9 HoxA10 Facilitates SHP-1-Catalyzed Dephosphorylation of p38 MAPK/STAT3 To Repress Hepatitis B Virus Replication by a Feedback Regulatory Mechanism.J Virol. 2019 Mar 21;93(7):e01607-18. doi: 10.1128/JVI.01607-18. Print 2019 Apr 1.
10 Endometrial Expression of Homeobox Genes and Cell Adhesion Molecules in Infertile Women With Intramural Fibroids During Window of Implantation.Reprod Sci. 2017 Mar;24(3):435-444. doi: 10.1177/1933719116657196. Epub 2016 Jul 19.
11 Long noncoding RNA LINC00483/microRNA-144 regulates radiosensitivity and epithelial-mesenchymal transition in lung adenocarcinoma by interacting with HOXA10.J Cell Physiol. 2019 Jul;234(7):11805-11821. doi: 10.1002/jcp.27886. Epub 2019 Feb 4.
12 Constitutively active SHP2 cooperates with HoxA10 overexpression to induce acute myeloid leukemia.J Biol Chem. 2009 Jan 23;284(4):2549-67. doi: 10.1074/jbc.M804704200. Epub 2008 Nov 19.
13 HOXA10 expression profiling in prostate cancer.Prostate. 2019 Apr;79(5):554-563. doi: 10.1002/pros.23761. Epub 2019 Jan 6.
14 Comprehensive clinical implications of homeobox A10 in 3,199 cases of non-small cell lung cancer tissue samples combining qRT-PCR, RNA sequencing and microarray data.Am J Transl Res. 2019 Jan 15;11(1):45-66. eCollection 2019.
15 Quercetin inhibits cell viability, migration and invasion by regulating miR-16/HOXA10 axis in oral cancer.Eur J Pharmacol. 2019 Mar 15;847:11-18. doi: 10.1016/j.ejphar.2019.01.006. Epub 2019 Jan 9.
16 Metformin Regulates Key MicroRNAs to Improve Endometrial Receptivity Through Increasing Implantation Marker Gene Expression in Patients with PCOS Undergoing IVF/ICSI.Reprod Sci. 2019 Nov;26(11):1439-1448. doi: 10.1177/1933719118820466. Epub 2019 Jan 1.
17 Clinical, cytogenetic and molecular characteristics of 14 T-ALL patients carrying the TCRbeta-HOXA rearrangement: a study of the Groupe Francophone de Cytogntique Hmatologique.Leukemia. 2007 Jan;21(1):121-8. doi: 10.1038/sj.leu.2404410. Epub 2006 Oct 12.
18 Homeobox A10 promotes the proliferation and invasion of bladder cancer cells via regulation of matrix metalloproteinase-3.Oncol Lett. 2019 Jul;18(1):49-56. doi: 10.3892/ol.2019.10312. Epub 2019 May 3.
19 A long-range interactive DNA methylation marker panel for the promoters of HOXA9 and HOXA10 predicts survival in breast cancer patients.Clin Epigenetics. 2017 Jul 24;9:73. doi: 10.1186/s13148-017-0373-z. eCollection 2017.
20 Relationship between COPD and polymorphisms of HOX-1 and mEPH in a Chinese population.Oncol Rep. 2007 Feb;17(2):483-8.
21 HOXA10 deteriorates gastric cancer through activating JAK1/STAT3 signaling pathway.Cancer Manag Res. 2019 Jul 15;11:6625-6635. doi: 10.2147/CMAR.S201342. eCollection 2019.
22 LINC00355 Promotes Tumor Progression in HNSCC by Hindering MicroRNA-195-Mediated Suppression of HOXA10 Expression.Mol Ther Nucleic Acids. 2020 Mar 6;19:61-71. doi: 10.1016/j.omtn.2019.11.002. Epub 2019 Nov 15.
23 Downregulation of miR?35a predicts poor prognosis in acute myeloid leukemia and regulates leukemia progression via modulating HOXA10 expression.Mol Med Rep. 2018 Jul;18(1):1134-1140. doi: 10.3892/mmr.2018.9066. Epub 2018 May 23.
24 Genome-wide CpG island methylation analyses in non-small cell lung cancer patients.Carcinogenesis. 2013 Mar;34(3):513-21. doi: 10.1093/carcin/bgs363. Epub 2012 Nov 19.
25 Tumor-suppressor role of miR-139-5p in endometrial cancer.Cancer Cell Int. 2018 Apr 2;18:51. doi: 10.1186/s12935-018-0545-8. eCollection 2018.
26 HOXA10 induces BCL2 expression, inhibits apoptosis, and promotes cell proliferation in gastric cancer.Cancer Med. 2019 Sep;8(12):5651-5661. doi: 10.1002/cam4.2440. Epub 2019 Jul 30.
27 The E3 ubiquitin ligase Triad1 influences development of Mll-Ell-induced acute myeloid leukemia.Oncogene. 2018 May;37(19):2532-2544. doi: 10.1038/s41388-018-0131-5. Epub 2018 Feb 20.
28 LncHOXA10 drives liver TICs self-renewal and tumorigenesis via HOXA10 transcription activation.Mol Cancer. 2018 Dec 13;17(1):173. doi: 10.1186/s12943-018-0921-y.
29 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
30 Pharmacogenomic analysis of acute promyelocytic leukemia cells highlights CYP26 cytochrome metabolism in differential all-trans retinoic acid sensitivity. Blood. 2007 May 15;109(10):4450-60.
31 Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
32 A HOXA10 estrogen response element (ERE) is differentially regulated by 17 beta-estradiol and diethylstilbestrol (DES). J Mol Biol. 2004 Jul 23;340(5):1013-23. doi: 10.1016/j.jmb.2004.05.052.
33 Endocrine regulation of HOX genes. Endocr Rev. 2006 Jun;27(4):331-55. doi: 10.1210/er.2005-0018. Epub 2006 Apr 21.
34 Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
35 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
36 Synergistic effect of JQ1 and rapamycin for treatment of human osteosarcoma. Int J Cancer. 2015 May 1;136(9):2055-64.
37 Chemical stresses fail to mimic the unfolded protein response resulting from luminal load with unfolded polypeptides. J Biol Chem. 2018 Apr 13;293(15):5600-5612.
38 Bisphenol A-associated epigenomic changes in prepubescent girls: a cross-sectional study in Gharbiah, Egypt. Environ Health. 2013 Apr 16;12:33. doi: 10.1186/1476-069X-12-33.