General Information of Drug Off-Target (DOT) (ID: OTDGLB4J)

DOT Name Oxysterol-binding protein 2 (OSBP2)
Synonyms Oxysterol-binding protein-related protein 4; ORP-4; OSBP-related protein 4
Gene Name OSBP2
Related Disease
Age-related macular degeneration ( )
Cardiac failure ( )
Chronic myelomonocytic leukaemia ( )
Congenital contractural arachnodactyly ( )
Congestive heart failure ( )
Hepatitis C virus infection ( )
Methicillin-resistant staphylococci infection ( )
Pneumonia ( )
UniProt ID
OSBP2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01237 ; PF00169
Sequence
MGKAAAPSRGGGCGGRSRGLSSLFTVVPCLSCHTAAPGMSASTSGSGPEPKPQPQPVPEP
ERGPLSEQVSEAVSEAVPRSEPVSETTSEPEPGAGQPSELLQGSRPGSESSSGVGAGPFT
KAASEPLSRAVGSATFLRPESGSLPALKPLPLLRPGQAKTPLGVPMSGTGTTSSAPLALL
PLDSFEGWLLKWTNYLKGYQRRWFVLGNGLLSYYRNQGEMAHTCRGTINLSTAHIDTEDS
CGILLTSGARSYHLKASSEVDRQQWITALELAKAKAVRVMNTHSDDSGDDDEATTPADKS
ELHHTLKNLSLKLDDLSTCNDLIAKHGAALQRSLTELDGLKIPSESGEKLKVVNERATLF
RITSNAMINACRDFLELAEIHSRKWQRALQYEQEQRVHLEETIEQLAKQHNSLERAFHSA
PGRPANPSKSFIEGSLLTPKGEDSEEDEDTEYFDAMEDSTSFITVITEAKEDSRKAEGST
GTSSVDWSSADNVLDGASLVPKGSSKVKRRVRIPNKPNYSLNLWSIMKNCIGRELSRIPM
PVNFNEPLSMLQRLTEDLEYHHLLDKAVHCTSSVEQMCLVAAFSVSSYSTTVHRIAKPFN
PMLGETFELDRLDDMGLRSLCEQVSHHPPSAAHYVFSKHGWSLWQEITISSKFRGKYISI
MPLGAIHLEFQASGNHYVWRKSTSTVHNIIVGKLWIDQSGDIEIVNHKTNDRCQLKFLPY
SYFSKEAARKVTGVVSDSQGKAHYVLSGSWDEQMECSKVMHSSPSSPSSDGKQKTVYQTL
SAKLLWKKYPLPENAENMYYFSELALTLNEHEEGVAPTDSRLRPDQRLMEKGRWDEANTE
KQRLEEKQRLSRRRRLEACGPGSSCSSEEEKEADAYTPLWFEKRLDPLTGEMACVYKGGY
WEAKEKQDWHMCPNIF
Function Binds 7-ketocholesterol.
Tissue Specificity Expressed mainly in retina, testis, and fetal liver.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Age-related macular degeneration DIS0XS2C Strong Biomarker [1]
Cardiac failure DISDC067 Strong Biomarker [2]
Chronic myelomonocytic leukaemia DISDN5P7 Strong Genetic Variation [3]
Congenital contractural arachnodactyly DISOM1K7 Strong Biomarker [4]
Congestive heart failure DIS32MEA Strong Biomarker [2]
Hepatitis C virus infection DISQ0M8R Strong Altered Expression [5]
Methicillin-resistant staphylococci infection DIS6DRDZ moderate Biomarker [6]
Pneumonia DIS8EF3M moderate Biomarker [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
This DOT Affected the Drug Response of 1 Drug(s)
Drug Name Drug ID Highest Status Interaction REF
Gemcitabine DMSE3I7 Approved Oxysterol-binding protein 2 (OSBP2) increases the Neutropenia ADR of Gemcitabine. [22]
------------------------------------------------------------------------------------
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Oxysterol-binding protein 2 (OSBP2). [7]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Oxysterol-binding protein 2 (OSBP2). [8]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Oxysterol-binding protein 2 (OSBP2). [9]
Cisplatin DMRHGI9 Approved Cisplatin affects the expression of Oxysterol-binding protein 2 (OSBP2). [10]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Oxysterol-binding protein 2 (OSBP2). [11]
Decitabine DMQL8XJ Approved Decitabine affects the expression of Oxysterol-binding protein 2 (OSBP2). [10]
Selenium DM25CGV Approved Selenium increases the expression of Oxysterol-binding protein 2 (OSBP2). [12]
Cannabidiol DM0659E Approved Cannabidiol increases the expression of Oxysterol-binding protein 2 (OSBP2). [13]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Oxysterol-binding protein 2 (OSBP2). [14]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Oxysterol-binding protein 2 (OSBP2). [16]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Oxysterol-binding protein 2 (OSBP2). [18]
Sulforaphane DMQY3L0 Investigative Sulforaphane decreases the expression of Oxysterol-binding protein 2 (OSBP2). [19]
KOJIC ACID DMP84CS Investigative KOJIC ACID decreases the expression of Oxysterol-binding protein 2 (OSBP2). [20]
1,6-hexamethylene diisocyanate DMLB3RT Investigative 1,6-hexamethylene diisocyanate affects the expression of Oxysterol-binding protein 2 (OSBP2). [21]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Oxysterol-binding protein 2 (OSBP2). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the methylation of Oxysterol-binding protein 2 (OSBP2). [17]
------------------------------------------------------------------------------------

References

1 Mutation analysis of oxisterol-binding-protein gene in patients with age-related macular degeneration.Genet Test. 2007 Winter;11(4):421-6. doi: 10.1089/gte.2007.0021.
2 Structural and myocardial dysfunction in heart failure beyond ejection fraction.Heart Fail Rev. 2020 Jan;25(1):9-17. doi: 10.1007/s10741-019-09828-8.
3 Essential role of PTPN11 mutation in enhanced haematopoietic differentiation potential of induced pluripotent stem cells of juvenile myelomonocytic leukaemia.Br J Haematol. 2019 Oct;187(2):163-173. doi: 10.1111/bjh.16060. Epub 2019 Jun 20.
4 Expression of oxysterol binding protein isoforms in opisthorchiasis-associated cholangiocarcinoma: a potential molecular marker for tumor metastasis.Parasitol Int. 2012 Mar;61(1):136-9. doi: 10.1016/j.parint.2011.07.003. Epub 2011 Jul 8.
5 Inhibition of HCV replication by oxysterol-binding protein-related protein 4 (ORP4) through interaction with HCV NS5B and alteration of lipid droplet formation.PLoS One. 2013 Sep 17;8(9):e75648. doi: 10.1371/journal.pone.0075648. eCollection 2013.
6 Modification Targeting the "Rana Box" Motif of a Novel Nigrocin Peptide From Hylarana latouchii Enhances and Broadens Its Potency Against Multiple Bacteria.Front Microbiol. 2018 Nov 28;9:2846. doi: 10.3389/fmicb.2018.02846. eCollection 2018.
7 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
8 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
9 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
10 Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
11 Bisphenol-A and estradiol exert novel gene regulation in human MCF-7 derived breast cancer cells. Mol Cell Endocrinol. 2004 Jun 30;221(1-2):47-55. doi: 10.1016/j.mce.2004.04.010.
12 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
13 Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
14 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
16 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
17 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
18 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
19 Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
20 Toxicogenomics of kojic acid on gene expression profiling of a375 human malignant melanoma cells. Biol Pharm Bull. 2006 Apr;29(4):655-69.
21 Gene profiles of THP-1 macrophages after in vitro exposure to respiratory (non-)sensitizing chemicals: identification of discriminating genetic markers and pathway analysis. Toxicol In Vitro. 2009 Sep;23(6):1151-62. doi: 10.1016/j.tiv.2009.06.007. Epub 2009 Jun 13.
22 Genome-wide association study of chemotherapeutic agent-induced severe neutropenia/leucopenia for patients in Biobank Japan. Cancer Sci. 2013 Aug;104(8):1074-82. doi: 10.1111/cas.12186. Epub 2013 Jun 10.