Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTEBJNVG)

• DOT Name: Maturin (MTURN)
• Synonyms: Maturin neural progenitor differentiation regulator protein homolog; Protein Ells1
• Gene Name: MTURN
• Related Disease:
  Lung cancer
  Lung carcinoma
• UniProt ID: MTURN_HUMAN
• Pfam ID: PF15167
• Sequence:
  MDFQQLADVAEKWCSNTPFELIATEETERRMDFYADPGVSFYVLCPDNGCGDNFHVWSES
  EDCLPFLQLAQDYISSCGKKTLHEVLEKVFKSFRPLLGLPDADDDAFEEYSADVEEEEPE
  ADHPQMGVSQQ
• Function: Promotes megakaryocyte differentiation by enhancing ERK and JNK signaling as well as up-regulating RUNX1 and FLI1 expression. Represses NF-kappa-B transcriptional activity by inhibiting phosphorylation of RELA at 'Ser-536'. May be involved in early neuronal development.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Lung cancer	DISCM4YA	Strong	Altered Expression	[1]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[1]

This DOT Affected the Drug Response of 2 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Temozolomide	DMKECZD	Approved	Maturin (MTURN) affects the response to substance of Temozolomide.	[14]
DTI-015	DMXZRW0	Approved	Maturin (MTURN) affects the response to substance of DTI-015.	[14]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Maturin (MTURN).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Maturin (MTURN).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Maturin (MTURN).	[4]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Maturin (MTURN).	[5]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Maturin (MTURN).	[5]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Maturin (MTURN).	[6]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Maturin (MTURN).	[7]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Maturin (MTURN).	[8]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Maturin (MTURN).	[9]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Maturin (MTURN).	[11]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Maturin (MTURN).	[12]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Maturin (MTURN).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Maturin (MTURN).	[10]

References

• [1] A three-platelet mRNA set: MAX, MTURN and HLA-B as biomarker for lung cancer.J Cancer Res Clin Oncol. 2019 Nov;145(11):2713-2723. doi: 10.1007/s00432-019-03032-9. Epub 2019 Sep 24.
• [2] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [3] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [4] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [5] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [6] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [7] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [8] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [9] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [12] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [13] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [14] Tumor necrosis factor-alpha-induced protein 3 as a putative regulator of nuclear factor-kappaB-mediated resistance to O6-alkylating agents in human glioblastomas. J Clin Oncol. 2006 Jan 10;24(2):274-87. doi: 10.1200/JCO.2005.02.9405. Epub 2005 Dec 19.