Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFEZ5AI)

• DOT Name: Steroidogenic acute regulatory protein, mitochondrial (STAR)
• Synonyms: StAR; START domain-containing protein 1; StARD1
• Gene Name: STAR
• Related Disease: Congenital lipoid adrenal hyperplasia due to STAR deficency
• UniProt ID: STAR_HUMAN
• PDB ID: 3P0L; 5OMA; 6T5F; 6T5H
• Pfam ID: PF01852
• Sequence:
  MLLATFKLCAGSSYRHMRNMKGLRQQAVMAISQELNRRALGGPTPSTWINQVRRRSSLLG
  SRLEETLYSDQELAYLQQGEEAMQKALGILSNQEGWKKESQQDNGDKVMSKVVPDVGKVF
  RLEVVVDQPMERLYEELVERMEAMGEWNPNVKEIKVLQKIGKDTFITHELAAEAAGNLVG
  PRDFVSVRCAKRRGSTCVLAGMATDFGNMPEQKGVIRAEHGPTCMVLHPLAGSPSKTKLT
  WLLSIDLKGWLPKSIINQVLSQTQVDFANHLRKRLESHPASEARC
• Function: Plays a key role in steroid hormone synthesis by enhancing the metabolism of cholesterol into pregnenolone. Mediates the transfer of cholesterol from the outer mitochondrial membrane to the inner mitochondrial membrane where it is cleaved to pregnenolone.
• Tissue Specificity: Expressed in gonads, adrenal cortex and kidney.
• KEGG Pathway:
  Ovarian steroidogenesis (hsa04913)
  Aldosterone synthesis and secretion (hsa04925)
  Cortisol synthesis and secretion (hsa04927)
  Cushing syndrome (hsa04934)
  Cholesterol metabolism (hsa04979)
• Reactome Pathway: Pregnenolone biosynthesis (R-HSA-196108)

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Congenital lipoid adrenal hyperplasia due to STAR deficency	DISPM51J	Definitive	Autosomal recessive	[1]

This DOT Affected the Regulation of Drug Effects of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
ANW-32821	DMMJOZD	Phase 2	Steroidogenic acute regulatory protein, mitochondrial (STAR) increases the transport of ANW-32821.	[38]

41 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[4]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[5]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[6]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[7]
Carbamazepine	DMZOLBI	Approved	Carbamazepine decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[8]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[9]
Dexamethasone	DMMWZET	Approved	Dexamethasone decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[10]
Rosiglitazone	DMILWZR	Approved	Rosiglitazone increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[11]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[12]
Nicotine	DMWX5CO	Approved	Nicotine decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[13]
Mifepristone	DMGZQEF	Approved	Mifepristone decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[14]
Lindane	DMB8CNL	Approved	Lindane increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[15]
Hydrocortisone	DMGEMB7	Approved	Hydrocortisone decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[16]
Dinoprostone	DMTYOPD	Approved	Dinoprostone decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[17]
Etretinate	DM2CZFA	Approved	Etretinate increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[18]
Aminoglutethimide	DMWFHMZ	Approved	Aminoglutethimide decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[19]
Mitotane	DMU1GX0	Approved	Mitotane decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[20]
Lamotrigine	DM8SXYG	Approved	Lamotrigine decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[8]
Fluconazole	DMOWZ6B	Approved	Fluconazole increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[21]
Levetiracetam	DMTGDN8	Approved	Levetiracetam decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[2]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[22]
Dalcetrapib	DMKNCVM	Phase 3	Dalcetrapib increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[23]
Anacetrapib	DMP2BFG	Phase 3	Anacetrapib increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[23]
Genistein	DM0JETC	Phase 2/3	Genistein increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[24]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[26]
Torcetrapib	DMDHYM7	Discontinued in Phase 2	Torcetrapib increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[27]
Antalarmin	DM2EKX5	Terminated	Antalarmin decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[28]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[29]
Forskolin	DM6ITNG	Investigative	Forskolin increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[30]
Tributylstannanyl	DMHN7CB	Investigative	Tributylstannanyl decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[31]
Dibutyl phthalate	DMEDGKO	Investigative	Dibutyl phthalate decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[32]
27-hydroxycholesterol	DM2L6OZ	Investigative	27-hydroxycholesterol increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[33]
GW-3965	DMG60ET	Investigative	GW-3965 decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[34]
propylpyrazoletriol	DMTCP8K	Investigative	propylpyrazoletriol increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[35]
diarylpropionitril	DM14X29	Investigative	diarylpropionitril increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[35]
1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane	DMDJYHK	Investigative	1,2-dibromo-4-(1,2-dibromoethyl)cyclohexane increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[36]
2-bromophenol	DM6JDIY	Investigative	2-bromophenol increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[37]
3-MeSO2-DDE	DMAWEQH	Investigative	3-MeSO2-DDE increases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[38]
astressin	DMSFLTK	Investigative	astressin decreases the expression of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[28]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Steroidogenic acute regulatory protein, mitochondrial (STAR).	[25]

References

• [1] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [2] Differential effects of antiepileptic drugs on steroidogenesis in a human in vitro cell model. Acta Neurol Scand Suppl. 2009;(189):14-21.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [6] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [7] Essential role of cell cycle regulatory genes p21 and p27 expression in inhibition of breast cancer cells by arsenic trioxide. Med Oncol. 2011 Dec;28(4):1225-54.
• [8] Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
• [9] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [10] Low H3K27 acetylation of SF1 in PBMC: a biomarker for prenatal dexamethasone exposure-caused adrenal insufficiency of steroid synthesis in male offspring. Cell Biol Toxicol. 2023 Oct;39(5):2051-2067. doi: 10.1007/s10565-021-09691-0. Epub 2022 Mar 4.
• [11] Direct rosiglitazone action on steroidogenesis and proinflammatory factor production in human granulosa-lutein cells. Reprod Biol Endocrinol. 2009 Dec 9;7:147. doi: 10.1186/1477-7827-7-147.
• [12] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [13] Nicotine induced CpG methylation of Pax6 binding motif in StAR promoter reduces the gene expression and cortisol production. Toxicol Appl Pharmacol. 2011 Dec 15;257(3):328-37.
• [14] Mifepristone induced progesterone withdrawal reveals novel regulatory pathways in human endometrium. Mol Hum Reprod. 2007 Sep;13(9):641-54.
• [15] Steroidogenic gene expression in H295R cells and the human adrenal gland: adrenotoxic effects of lindane in vitro. J Appl Toxicol. 2006 Nov-Dec;26(6):484-92.
• [16] Glucocorticoid-activation system mediated glucocorticoid-insulin-like growth factor 1 (GC-IGF1) axis programming alteration of adrenal dysfunction induced by prenatal caffeine exposure. Toxicol Lett. 2019 Mar 1;302:7-17.
• [17] Expression of adrenomedullin in human ovaries, ovarian sex cord-stromal tumors and cultured granulosa-luteal cells. Gynecol Endocrinol. 2009 Feb;25(2):96-103. doi: 10.1080/09513590802488412.
• [18] Retinoids and retinol differentially regulate steroid biosynthesis in ovarian theca cells isolated from normal cycling women and women with polycystic ovary syndrome. J Clin Endocrinol Metab. 2005 Aug;90(8):4858-65. doi: 10.1210/jc.2005-0330. Epub 2005 May 24.
• [19] The H295R system for evaluation of endocrine-disrupting effects. Ecotoxicol Environ Saf. 2006 Nov;65(3):293-305.
• [20] Mitotane exhibits dual effects on steroidogenic enzymes gene transcription under basal and cAMP-stimulating microenvironments in NCI-H295 cells. Toxicology. 2012 Aug 16;298(1-3):14-23.
• [21] Fluconazole inhibits human adrenocortical steroidogenesis in vitro. J Endocrinol. 2012 Dec;215(3):403-12. doi: 10.1530/JOE-12-0310. Epub 2012 Oct 4.
• [22] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [23] Cholesteryl ester-transfer protein inhibitors stimulate aldosterone biosynthesis in adipocytes through Nox-dependent processes. J Pharmacol Exp Ther. 2015 Apr;353(1):27-34.
• [24] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [25] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [26] Inheritable stimulatory effects of caffeine on steroidogenic acute regulatory protein expression and cortisol production in human adrenocortical cells. Chem Biol Interact. 2012 Jan 5;195(1):68-75. doi: 10.1016/j.cbi.2011.11.001. Epub 2011 Nov 12.
• [27] Steroid profiling in H295R cells to identify chemicals potentially disrupting the production of adrenal steroids. Toxicology. 2017 Apr 15;381:51-63.
• [28] Corticotropin-releasing hormone (CRH) and urocortin act through type 1 CRH receptors to stimulate dehydroepiandrosterone sulfate production in human fetal adrenal cells. J Clin Endocrinol Metab. 2005 Sep;90(9):5393-400.
• [29] Effects of bisphenol analogues on steroidogenic gene expression and hormone synthesis in H295R cells. Chemosphere. 2016 Mar;147:9-19.
• [30] A benzimidazole fungicide, benomyl, and its metabolite, carbendazim, induce aromatase activity in a human ovarian granulose-like tumor cell line (KGN). Endocrinology. 2004 Apr;145(4):1860-9.
• [31] Organotin exposure stimulates steroidogenesis in H295R Cell via cAMP pathway. Ecotoxicol Environ Saf. 2018 Jul 30;156:148-153.
• [32] Dibutyl phthalate impairs steroidogenesis and a subset of LH-dependent genes in cultured human mural granulosa cell in vitro. Reprod Toxicol. 2017 Apr;69:13-18.
• [33] Detection of the steroidogenic acute regulatory protein, StAR, in human liver cells. Biochim Biophys Acta. 2005 Apr 15;1733(2-3):111-9. doi: 10.1016/j.bbalip.2005.01.004. Epub 2005 Mar 2.
• [34] Inhibition of progesterone production in human luteinized granulosa cells treated with LXR agonists. Mol Hum Reprod. 2007 Jun;13(6):373-9.
• [35] Bisphenol A stimulates steroidogenic acute regulatory protein expression via an unknown mechanism in adrenal cortical cells. J Cell Biochem. 2019 Feb;120(2):2429-2438. doi: 10.1002/jcb.27574. Epub 2018 Sep 11.
• [36] Androgen receptor modulation following combination exposure to brominated flame-retardants. Sci Rep. 2018 Mar 19;8(1):4843. doi: 10.1038/s41598-018-23181-0.
• [37] Effects of brominated flame retardants and brominated dioxins on steroidogenesis in H295R human adrenocortical carcinoma cell line. Environ Toxicol Chem. 2007 Apr;26(4):764-72.
• [38] Biphasic hormonal responses to the adrenocorticolytic DDT metabolite 3-methylsulfonyl-DDE in human cells. Toxicol Appl Pharmacol. 2010 Feb 1;242(3):281-9.