Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTLF4ZB1)

DOT Name	Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK)
Synonyms	I-kappa-B kinase alpha; IKK-A; IKK-alpha; IkBKA; IkappaB kinase; EC 2.7.11.10; Conserved helix-loop-helix ubiquitous kinase; I-kappa-B kinase 1; IKK-1; IKK1; Nuclear factor NF-kappa-B inhibitor kinase alpha; NFKBIKA; Transcription factor 16; TCF-16
Gene Name	CHUK
Related Disease	Cocoon syndrome ( )
UniProt ID	IKKA_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
PDB ID	3BRT; 5EBZ; 5TQW; 5TQX; 5TQY
EC Number	2.7.11.10
Pfam ID	PF18397 ; PF12179 ; PF00069
Sequence	MERPPGLRPGAGGPWEMRERLGTGGFGNVCLYQHRELDLKIAIKSCRLELSTKNRERWCH EIQIMKKLNHANVVKACDVPEELNILIHDVPLLAMEYCSGGDLRKLLNKPENCCGLKESQ ILSLLSDIGSGIRYLHENKIIHRDLKPENIVLQDVGGKIIHKIIDLGYAKDVDQGSLCTS FVGTLQYLAPELFENKPYTATVDYWSFGTMVFECIAGYRPFLHHLQPFTWHEKIKKKDPK CIFACEEMSGEVRFSSHLPQPNSLCSLVVEPMENWLQLMLNWDPQQRGGPVDLTLKQPRC FVLMDHILNLKIVHILNMTSAKIISFLLPPDESLHSLQSRIERETGINTGSQELLSETGI SLDPRKPASQCVLDGVRGCDSYMVYLFDKSKTVYEGPFASRSLSDCVNYIVQDSKIQLPI IQLRKVWAEAVHYVSGLKEDYSRLFQGQRAAMLSLLRYNANLTKMKNTLISASQQLKAKL EFFHKSIQLDLERYSEQMTYGISSEKMLKAWKEMEEKAIHYAEVGVIGYLEDQIMSLHAE IMELQKSPYGRRQGDLMESLEQRAIDLYKQLKHRPSDHSYSDSTEMVKIIVHTVQSQDRV LKELFGHLSKLLGCKQKIIDLLPKVEVALSNIKEADNTVMFMQGKRQKEIWHLLKIACTQ SSARSLVGSSLEGAVTPQTSAWLPPTSAEHDHSLSCVVTPQDGETSAQMIEENLNCLGHL STIIHEANEEQGNSMMNLDWSWLTE
Function	Serine kinase that plays an essential role in the NF-kappa-B signaling pathway which is activated by multiple stimuli such as inflammatory cytokines, bacterial or viral products, DNA damages or other cellular stresses. Acts as a part of the canonical IKK complex in the conventional pathway of NF-kappa-B activation and phosphorylates inhibitors of NF-kappa-B on serine residues. These modifications allow polyubiquitination of the inhibitors and subsequent degradation by the proteasome. In turn, free NF-kappa-B is translocated into the nucleus and activates the transcription of hundreds of genes involved in immune response, growth control, or protection against apoptosis. Negatively regulates the pathway by phosphorylating the scaffold protein TAXBP1 and thus promoting the assembly of the A20/TNFAIP3 ubiquitin-editing complex (composed of A20/TNFAIP3, TAX1BP1, and the E3 ligases ITCH and RNF11). Therefore, CHUK plays a key role in the negative feedback of NF-kappa-B canonical signaling to limit inflammatory gene activation. As part of the non-canonical pathway of NF-kappa-B activation, the MAP3K14-activated CHUK/IKKA homodimer phosphorylates NFKB2/p100 associated with RelB, inducing its proteolytic processing to NFKB2/p52 and the formation of NF-kappa-B RelB-p52 complexes. In turn, these complexes regulate genes encoding molecules involved in B-cell survival and lymphoid organogenesis. Participates also in the negative feedback of the non-canonical NF-kappa-B signaling pathway by phosphorylating and destabilizing MAP3K14/NIK. Within the nucleus, phosphorylates CREBBP and consequently increases both its transcriptional and histone acetyltransferase activities. Modulates chromatin accessibility at NF-kappa-B-responsive promoters by phosphorylating histones H3 at 'Ser-10' that are subsequently acetylated at 'Lys-14' by CREBBP. Additionally, phosphorylates the CREBBP-interacting protein NCOA3. Also phosphorylates FOXO3 and may regulate this pro-apoptotic transcription factor. Phosphorylates RIPK1 at 'Ser-25' which represses its kinase activity and consequently prevents TNF-mediated RIPK1-dependent cell death. Phosphorylates AMBRA1 following mitophagy induction, promoting AMBRA1 interaction with ATG8 family proteins and its mitophagic activity.
Tissue Specificity	Widely expressed.
KEGG Pathway	Antifolate resistance (hsa01523 ) MAPK sig.ling pathway (hsa04010 ) Ras sig.ling pathway (hsa04014 ) Chemokine sig.ling pathway (hsa04062 ) NF-kappa B sig.ling pathway (hsa04064 ) FoxO sig.ling pathway (hsa04068 ) mTOR sig.ling pathway (hsa04150 ) PI3K-Akt sig.ling pathway (hsa04151 ) Apoptosis (hsa04210 ) Osteoclast differentiation (hsa04380 ) Toll-like receptor sig.ling pathway (hsa04620 ) NOD-like receptor sig.ling pathway (hsa04621 ) RIG-I-like receptor sig.ling pathway (hsa04622 ) Cytosolic D.-sensing pathway (hsa04623 ) C-type lectin receptor sig.ling pathway (hsa04625 ) IL-17 sig.ling pathway (hsa04657 ) Th1 and Th2 cell differentiation (hsa04658 ) Th17 cell differentiation (hsa04659 ) T cell receptor sig.ling pathway (hsa04660 ) B cell receptor sig.ling pathway (hsa04662 ) TNF sig.ling pathway (hsa04668 ) Adipocytokine sig.ling pathway (hsa04920 ) Alcoholic liver disease (hsa04936 ) Alzheimer disease (hsa05010 ) Epithelial cell sig.ling in Helicobacter pylori infection (hsa05120 ) Pathogenic Escherichia coli infection (hsa05130 ) Shigellosis (hsa05131 ) Salmonella infection (hsa05132 ) Yersinia infection (hsa05135 ) Chagas disease (hsa05142 ) Toxoplasmosis (hsa05145 ) Hepatitis C (hsa05160 ) Hepatitis B (hsa05161 ) Measles (hsa05162 ) Human cytomegalovirus infection (hsa05163 ) Influenza A (hsa05164 ) Human papillomavirus infection (hsa05165 ) Human T-cell leukemia virus 1 infection (hsa05166 ) Kaposi sarcoma-associated herpesvirus infection (hsa05167 ) Herpes simplex virus 1 infection (hsa05168 ) Epstein-Barr virus infection (hsa05169 ) Human immunodeficiency virus 1 infection (hsa05170 ) Coro.virus disease - COVID-19 (hsa05171 ) Pathways in cancer (hsa05200 ) Chemical carcinogenesis - reactive oxygen species (hsa05208 ) Pancreatic cancer (hsa05212 ) Prostate cancer (hsa05215 ) Chronic myeloid leukemia (hsa05220 ) Acute myeloid leukemia (hsa05221 ) Small cell lung cancer (hsa05222 ) PD-L1 expression and PD-1 checkpoint pathway in cancer (hsa05235 ) Lipid and atherosclerosis (hsa05417 ) Fluid shear stress and atherosclerosis (hsa05418 )
Reactome Pathway	ER-Phagosome pathway (R-HSA-1236974 ) NOD1/2 Signaling Pathway (R-HSA-168638 ) TICAM1, RIP1-mediated IKK complex recruitment (R-HSA-168927 ) RIP-mediated NFkB activation via ZBP1 (R-HSA-1810476 ) AKT phosphorylates targets in the cytosol (R-HSA-198323 ) Downstream TCR signaling (R-HSA-202424 ) FCERI mediated NF-kB activation (R-HSA-2871837 ) TAK1-dependent IKK and NF-kappa-B activation (R-HSA-445989 ) Regulation of TNFR1 signaling (R-HSA-5357905 ) TNFR1-induced NF-kappa-B signaling pathway (R-HSA-5357956 ) IKBKB deficiency causes SCID (R-HSA-5602636 ) IKBKG deficiency causes anhidrotic ectodermal dysplasia with immunodeficiency (EDA-ID) (via TLR) (R-HSA-5603027 ) IkBA variant leads to EDA-ID (R-HSA-5603029 ) Dectin-1 mediated noncanonical NF-kB signaling (R-HSA-5607761 ) CLEC7A (Dectin-1) signaling (R-HSA-5607764 ) Constitutive Signaling by AKT1 E17K in Cancer (R-HSA-5674400 ) NIK-->noncanonical NF-kB signaling (R-HSA-5676590 ) MAP3K8 (TPL2)-dependent MAPK1/3 activation (R-HSA-5684264 ) Interleukin-1 signaling (R-HSA-9020702 ) TRAF6 mediated NF-kB activation (R-HSA-933542 ) NF-kB activation through FADD/RIP-1 pathway mediated by caspase-8 and -10 (R-HSA-933543 ) IRAK1 recruits IKK complex (R-HSA-937039 ) IKK complex recruitment mediated by RIP1 (R-HSA-937041 ) SARS-CoV-2 activates/modulates innate and adaptive immune responses (R-HSA-9705671 ) IRAK1 recruits IKK complex upon TLR7/8 or 9 stimulation (R-HSA-975144 ) Regulation of NF-kappa B signaling (R-HSA-9758274 ) PKR-mediated signaling (R-HSA-9833482 ) Activation of NF-kappaB in B cells (R-HSA-1169091 )

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance		REF
Cocoon syndrome	DISTY8P7	Definitive	Autosomal recessive	[1]
------------------------------------------------------------------------------------

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[2]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[3]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[4]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[5]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[8]
Marinol	DM70IK5	Approved	Marinol decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[10]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[11]
Bortezomib	DMNO38U	Approved	Bortezomib increases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[12]
Etoposide	DMNH3PG	Approved	Etoposide decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[13]
Ibuprofen	DM8VCBE	Approved	Ibuprofen decreases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[16]
Glucosamine	DM4ZLFD	Approved	Glucosamine decreases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[17]
Nicotinamide	DMUPE07	Approved	Nicotinamide increases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[19]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[22]
Chloroquine	DMSI5CB	Phase 3 Trial	Chloroquine decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[23]
phorbol 12-myristate 13-acetate	DMJWD62	Phase 2	phorbol 12-myristate 13-acetate increases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[24]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[26]
MG-132	DMKA2YS	Preclinical	MG-132 increases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[28]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[29]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the activity of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[30]
OXYBENZONE	DMMZYX6	Investigative	OXYBENZONE increases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[32]
SNX-2112	DMB5A80	Investigative	SNX-2112 decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[33]
ROCAGLAMIDE	DME9VTX	Investigative	ROCAGLAMIDE decreases the expression of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[35]
------------------------------------------------------------------------------------


⏷ Show the Full List of 24 Drug(s)

8 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Vorinostat	DMWMPD4	Approved	Vorinostat decreases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[9]
Simvastatin	DM30SGU	Approved	Simvastatin increases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[14]
Melphalan	DMOLNHF	Approved	Melphalan affects the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[15]
Omacetaxine mepesuccinate	DMPU2WX	Approved	Omacetaxine mepesuccinate increases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[20]
Resveratrol	DM3RWXL	Phase 3	Resveratrol decreases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[21]
LY294002	DMY1AFS	Phase 1	LY294002 decreases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[25]
Kaempferol	DMHEMUB	Investigative	Kaempferol decreases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[31]
G15	DMMEC9D	Investigative	G15 decreases the phosphorylation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[34]
------------------------------------------------------------------------------------


⏷ Show the Full List of 8 Drug(s)

2 Drug(s) Affected the Protein Interaction/Cellular Processes of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
2-deoxyglucose	DMIAHVU	Approved	2-deoxyglucose affects the localization of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[18]
Geldanamycin	DMS7TC5	Discontinued in Phase 2	Geldanamycin increases the degradation of Inhibitor of nuclear factor kappa-B kinase subunit alpha (CHUK).	[27]
------------------------------------------------------------------------------------

References

1	Mutant CHUK and severe fetal encasement malformation. N Engl J Med. 2010 Oct 21;363(17):1631-7. doi: 10.1056/NEJMoa0911698.
2	Antiepileptic drugs are endocrine disruptors for the human fetal testis ex vivo. Toxicol Sci. 2023 Sep 28;195(2):169-183. doi: 10.1093/toxsci/kfad076.
3	Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4	Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
5	Estrogen Regulates MAPK-Related Genes through Genomic and Nongenomic Interactions between IGF-I Receptor Tyrosine Kinase and Estrogen Receptor-Alpha Signaling Pathways in Human Uterine Leiomyoma Cells. J Signal Transduct. 2012;2012:204236. doi: 10.1155/2012/204236. Epub 2012 Oct 9.
6	Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
7	Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
8	Arsenic trioxide exerts antimyeloma effects by inhibiting activity in the cytoplasmic substrates of histone deacetylase 6. PLoS One. 2012;7(2):e32215. doi: 10.1371/journal.pone.0032215. Epub 2012 Feb 22.
9	Combined effects of histone deacetylase inhibitor and rituximab on non-Hodgkin's B-lymphoma cells apoptosis. Exp Hematol. 2007 Dec;35(12):1801-11. doi: 10.1016/j.exphem.2007.06.009. Epub 2007 Aug 3.
10	THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
11	Transcriptomic Analysis of Stem Cells Treated with Moringin or Cannabidiol: Analogies and Differences in Inflammation Pathways. Int J Mol Sci. 2019 Nov 30;20(23):6039. doi: 10.3390/ijms20236039.
12	Synergistic antiproliferative effect of arsenic trioxide combined with bortezomib in HL60 cell line and primary blasts from patients affected by myeloproliferative disorders. Cancer Genet Cytogenet. 2010 Jun;199(2):110-20. doi: 10.1016/j.cancergencyto.2010.02.010.
13	Transcriptional repression of IKK by p53 in arsenite-induced GADD45 accumulation and apoptosis. Oncogene. 2019 Jan;38(5):731-746. doi: 10.1038/s41388-018-0478-7. Epub 2018 Sep 3.
14	Activation of nuclear factor-kappa B pathway by simvastatin and RhoA silencing increases doxorubicin cytotoxicity in human colon cancer HT29 cells. Mol Pharmacol. 2008 Aug;74(2):476-84.
15	Targeting the Fanconi anemia/BRCA pathway circumvents drug resistance in multiple myeloma. Cancer Res. 2009 Dec 15;69(24):9367-75. doi: 10.1158/0008-5472.CAN-09-2616.
16	Constitutive activation of IkappaB kinase alpha and NF-kappaB in prostate cancer cells is inhibited by ibuprofen. Oncogene. 1999 Dec 2;18(51):7389-94. doi: 10.1038/sj.onc.1203160.
17	A peptidyl-glucosamine derivative affects IKKalpha kinase activity in human chondrocytes. Arthritis Res Ther. 2010;12(1):R18. doi: 10.1186/ar2920. Epub 2010 Jan 29.
18	IKK inibition by a glucosamine derivative enhances Maspin expression in osteosarcoma cell line. Chem Biol Interact. 2017 Jan 25;262:19-28. doi: 10.1016/j.cbi.2016.12.005. Epub 2016 Dec 6.
19	Sirtuin-1 (SIRT1) is required for promoting chondrogenic differentiation of mesenchymal stem cells. J Biol Chem. 2014 Aug 8;289(32):22048-62. doi: 10.1074/jbc.M114.568790. Epub 2014 Jun 24.
20	Synergistic killing effects of homoharringtonine and arsenic trioxide on acute myeloid leukemia stem cells and the underlying mechanisms. J Exp Clin Cancer Res. 2019 Jul 15;38(1):308. doi: 10.1186/s13046-019-1295-8.
21	Resveratrol inhibits enterovirus 71 replication and pro-inflammatory cytokine secretion in rhabdosarcoma cells through blocking IKKs/NF-B signaling pathway. PLoS One. 2015 Feb 18;10(2):e0116879. doi: 10.1371/journal.pone.0116879. eCollection 2015.
22	Curcumin (diferuloylmethane) inhibits constitutive NF-kappaB activation, induces G1/S arrest, suppresses proliferation, and induces apoptosis in mantle cell lymphoma. Biochem Pharmacol. 2005 Sep 1;70(5):700-13. doi: 10.1016/j.bcp.2005.04.043.
23	Niclosamide, an anti-helminthic molecule, downregulates the retroviral oncoprotein Tax and pro-survival Bcl-2 proteins in HTLV-1-transformed T lymphocytes. Biochem Biophys Res Commun. 2015 Aug 14;464(1):221-228. doi: 10.1016/j.bbrc.2015.06.120. Epub 2015 Jun 23.
24	15-Deoxy-delta 12,14-prostaglandin J2 induces apoptosis in human malignant B cells: an effect associated with inhibition of NF-kappa B activity and down-regulation of antiapoptotic proteins. Blood. 2005 Feb 15;105(4):1750-8. doi: 10.1182/blood-2004-04-1360. Epub 2004 Oct 21.
25	Activation of PI3K/Akt/IKK-alpha/NF-kappaB signaling pathway is required for the apoptosis-evasion in human salivary adenoid cystic carcinoma: its inhibition by quercetin. Apoptosis. 2010 Jul;15(7):850-63. doi: 10.1007/s10495-010-0497-5.
26	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
27	Apoptosis induction by a novel retinoid-related molecule requires nuclear factor-kappaB activation. Cancer Res. 2005 Jun 1;65(11):4909-17. doi: 10.1158/0008-5472.CAN-04-4124.
28	Long-term incubation with proteasome inhibitors (PIs) induces IB degradation via the lysosomal pathway in an IB kinase (IKK)-dependent and IKK-independent manner. J Biol Chem. 2013 Nov 8;288(45):32777-32786. doi: 10.1074/jbc.M113.480921. Epub 2013 Oct 1.
29	Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
30	Gallic acid inhibits migration and invasion in human osteosarcoma U-2 OS cells through suppressing the matrix metalloproteinase-2/-9, protein kinase B (PKB) and PKC signaling pathways. Food Chem Toxicol. 2012 May;50(5):1734-40. doi: 10.1016/j.fct.2012.02.033. Epub 2012 Feb 25.
31	The anti-inflammatory flavones quercetin and kaempferol cause inhibition of inducible nitric oxide synthase, cyclooxygenase-2 and reactive C-protein, and down-regulation of the nuclear factor kappaB pathway in Chang Liver cells. Eur J Pharmacol. 2007 Feb 28;557(2-3):221-9.
32	Chromatin modifiers: A new class of pollutants with potential epigenetic effects revealed by in vitro assays and transcriptomic analyses. Toxicology. 2023 Jan 15;484:153413. doi: 10.1016/j.tox.2022.153413. Epub 2022 Dec 26.
33	The Hsp90 inhibitor SNX-2112, induces apoptosis in multidrug resistant K562/ADR cells through suppression of Akt/NF-B and disruption of mitochondria-dependent pathways. Chem Biol Interact. 2013 Sep 5;205(1):1-10. doi: 10.1016/j.cbi.2013.06.007. Epub 2013 Jun 15.
34	G15, a GPR30 antagonist, induces apoptosis and autophagy in human oral squamous carcinoma cells. Chem Biol Interact. 2013 Nov 25;206(2):375-84. doi: 10.1016/j.cbi.2013.10.014. Epub 2013 Oct 23.
35	Apoptotic activity of xanthoquinodin JBIR-99, from Parengyodontium album MEXU 30054, in PC-3 human prostate cancer cells. Chem Biol Interact. 2019 Sep 25;311:108798. doi: 10.1016/j.cbi.2019.108798. Epub 2019 Aug 18.