Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTO75RM7)

• DOT Name: Transcription factor E2F2 (E2F2)
• Synonyms: E2F-2
• Gene Name: E2F2
• UniProt ID: E2F2_HUMAN
• PDB ID: 1N4M
• Pfam ID: PF16421 ; PF02319
• Sequence:
  MLQGPRALASAAGQTPKVVPAMSPTELWPSGLSSPQLCPATATYYTPLYPQTAPPAAAPG
  TCLDATPHGPEGQVVRCLPAGRLPAKRKLDLEGIGRPVVPEFPTPKGKCIRVDGLPSPKT
  PKSPGEKTRYDTSLGLLTKKFIYLLSESEDGVLDLNWAAEVLDVQKRRIYDITNVLEGIQ
  LIRKKAKNNIQWVGRGMFEDPTRPGKQQQLGQELKELMNTEQALDQLIQSCSLSFKHLTE
  DKANKRLAYVTYQDIRAVGNFKEQTVIAVKAPPQTRLEVPDRTEDNLQIYLKSTQGPIEV
  YLCPEEVQEPDSPSEEPLPSTSTLCPSPDSAQPSSSTDPSIMEPTASSVPAPAPTPQQAP
  PPPSLVPLEATDSLLELPHPLLQQTEDQFLSPTLACSSPLISFSPSLDQDDYLWGLEAGE
  GISDLFDSYDLGDLLIN
• Function: Transcription activator that binds DNA cooperatively with DP proteins through the E2 recognition site, 5'-TTTC[CG]CGC-3' found in the promoter region of a number of genes whose products are involved in cell cycle regulation or in DNA replication. The DRTF1/E2F complex functions in the control of cell-cycle progression from g1 to s phase. E2F2 binds specifically to RB1 in a cell-cycle dependent manner.
• Tissue Specificity: Highest level of expression is found in placenta, low levels are found in lung. Found as well in many immortalized cell lines derived from tumor samples.
• KEGG Pathway:
  Endocrine resistance (hsa01522)
  Cell cycle (hsa04110)
  Cellular senescence (hsa04218)
  Cushing syndrome (hsa04934)
  Hepatitis C (hsa05160)
  Hepatitis B (hsa05161)
  Human cytomegalovirus infection (hsa05163)
  Human T-cell leukemia virus 1 infection (hsa05166)
  Kaposi sarcoma-associated herpesvirus infection (hsa05167)
  Epstein-Barr virus infection (hsa05169)
  Pathways in cancer (hsa05200)
  MicroR.s in cancer (hsa05206)
  Pancreatic cancer (hsa05212)
  Glioma (hsa05214)
  Prostate cancer (hsa05215)
  Melanoma (hsa05218)
  Bladder cancer (hsa05219)
  Chronic myeloid leukemia (hsa05220)
  Small cell lung cancer (hsa05222)
  Non-small cell lung cancer (hsa05223)
  Breast cancer (hsa05224)
  Hepatocellular carcinoma (hsa05225)
  Gastric cancer (hsa05226)
• Reactome Pathway:
  Oncogene Induced Senescence (R-HSA-2559585)
  Cyclin D associated events in G1 (R-HSA-69231)
  Defective binding of RB1 mutants to E2F1,(E2F2, E2F3) (R-HSA-9661069)
  Oxidative Stress Induced Senescence (R-HSA-2559580)

Molecular Interaction Atlas (MIA) of This DOT

40 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Transcription factor E2F2 (E2F2).	[1]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Transcription factor E2F2 (E2F2).	[2]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Transcription factor E2F2 (E2F2).	[3]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Transcription factor E2F2 (E2F2).	[4]
Estradiol	DMUNTE3	Approved	Estradiol affects the expression of Transcription factor E2F2 (E2F2).	[5]
Arsenic	DMTL2Y1	Approved	Arsenic decreases the expression of Transcription factor E2F2 (E2F2).	[6]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Transcription factor E2F2 (E2F2).	[7]
Arsenic trioxide	DM61TA4	Approved	Arsenic trioxide increases the expression of Transcription factor E2F2 (E2F2).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of Transcription factor E2F2 (E2F2).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Transcription factor E2F2 (E2F2).	[10]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Transcription factor E2F2 (E2F2).	[10]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Transcription factor E2F2 (E2F2).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Transcription factor E2F2 (E2F2).	[12]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Transcription factor E2F2 (E2F2).	[13]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil decreases the expression of Transcription factor E2F2 (E2F2).	[14]
Panobinostat	DM58WKG	Approved	Panobinostat decreases the expression of Transcription factor E2F2 (E2F2).	[15]
Niclosamide	DMJAGXQ	Approved	Niclosamide decreases the expression of Transcription factor E2F2 (E2F2).	[16]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Transcription factor E2F2 (E2F2).	[17]
Troglitazone	DM3VFPD	Approved	Troglitazone decreases the expression of Transcription factor E2F2 (E2F2).	[18]
Diclofenac	DMPIHLS	Approved	Diclofenac affects the expression of Transcription factor E2F2 (E2F2).	[12]
Amphotericin B	DMTAJQE	Approved	Amphotericin B increases the expression of Transcription factor E2F2 (E2F2).	[19]
Palbociclib	DMD7L94	Approved	Palbociclib decreases the expression of Transcription factor E2F2 (E2F2).	[20]
Ritonavir	DMU764S	Approved	Ritonavir decreases the expression of Transcription factor E2F2 (E2F2).	[21]
Cilostazol	DMZMSCT	Approved	Cilostazol decreases the expression of Transcription factor E2F2 (E2F2).	[22]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Transcription factor E2F2 (E2F2).	[23]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Transcription factor E2F2 (E2F2).	[24]
Belinostat	DM6OC53	Phase 2	Belinostat decreases the expression of Transcription factor E2F2 (E2F2).	[15]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the expression of Transcription factor E2F2 (E2F2).	[25]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Transcription factor E2F2 (E2F2).	[26]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Transcription factor E2F2 (E2F2).	[27]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Transcription factor E2F2 (E2F2).	[28]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Transcription factor E2F2 (E2F2).	[29]
Harmine	DMPA5WD	Patented	Harmine increases the expression of Transcription factor E2F2 (E2F2).	[30]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN decreases the expression of Transcription factor E2F2 (E2F2).	[31]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Transcription factor E2F2 (E2F2).	[32]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Transcription factor E2F2 (E2F2).	[33]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Transcription factor E2F2 (E2F2).	[34]
3R14S-OCHRATOXIN A	DM2KEW6	Investigative	3R14S-OCHRATOXIN A decreases the expression of Transcription factor E2F2 (E2F2).	[35]
GW-3965	DMG60ET	Investigative	GW-3965 decreases the expression of Transcription factor E2F2 (E2F2).	[36]
NSC-654077	DMW3QAK	Investigative	NSC-654077 decreases the expression of Transcription factor E2F2 (E2F2).	[37]

References

• [1] Stem cell transcriptome responses and corresponding biomarkers that indicate the transition from adaptive responses to cytotoxicity. Chem Res Toxicol. 2017 Apr 17;30(4):905-922.
• [2] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [3] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [4] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [5] Inhibition of E2F1 activity and cell cycle progression by arsenic via retinoblastoma protein. Cell Cycle. 2017;16(21):2058-2072. doi: 10.1080/15384101.2017.1338221. Epub 2017 Sep 28.
• [6] Genome-wide analysis of BEAS-2B cells exposed to trivalent arsenicals and dimethylthioarsinic acid. Toxicology. 2010 Jan 31;268(1-2):31-9.
• [7] Inhibition of prostate cancer cell colony formation by the flavonoid quercetin correlates with modulation of specific regulatory genes. Clin Diagn Lab Immunol. 2004 Jan;11(1):63-9. doi: 10.1128/cdli.11.1.63-69.2004.
• [8] Arsenic trioxide induces different gene expression profiles of genes related to growth and apoptosis in glioma cells dependent on the p53 status. Mol Biol Rep. 2008 Sep;35(3):421-9.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [11] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [12] Drug-induced endoplasmic reticulum and oxidative stress responses independently sensitize toward TNF-mediated hepatotoxicity. Toxicol Sci. 2014 Jul;140(1):144-59. doi: 10.1093/toxsci/kfu072. Epub 2014 Apr 20.
• [13] The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
• [14] New insights into the mechanisms underlying 5-fluorouracil-induced intestinal toxicity based on transcriptomic and metabolomic responses in human intestinal organoids. Arch Toxicol. 2021 Aug;95(8):2691-2718. doi: 10.1007/s00204-021-03092-2. Epub 2021 Jun 20.
• [15] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [16] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [17] Cannabidiol enhances cytotoxicity of anti-cancer drugs in human head and neck squamous cell carcinoma. Sci Rep. 2020 Nov 26;10(1):20622. doi: 10.1038/s41598-020-77674-y.
• [18] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [19] Differential expression of microRNAs and their predicted targets in renal cells exposed to amphotericin B and its complex with copper (II) ions. Toxicol Mech Methods. 2017 Sep;27(7):537-543. doi: 10.1080/15376516.2017.1333554. Epub 2017 Jun 8.
• [20] Cdk4/6 inhibition induces epithelial-mesenchymal transition and enhances invasiveness in pancreatic cancer cells. Mol Cancer Ther. 2012 Oct;11(10):2138-48. doi: 10.1158/1535-7163.MCT-12-0562. Epub 2012 Aug 6.
• [21] Ritonavir blocks AKT signaling, activates apoptosis and inhibits migration and invasion in ovarian cancer cells. Mol Cancer. 2009 Apr 22;8:26. doi: 10.1186/1476-4598-8-26.
• [22] Cilostazol inhibits vascular smooth muscle cell growth by downregulation of the transcription factor E2F. Hypertension. 2005 Apr;45(4):552-6. doi: 10.1161/01.HYP.0000158263.64320.eb. Epub 2005 Feb 21.
• [23] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [24] The molecular basis of genistein-induced mitotic arrest and exit of self-renewal in embryonal carcinoma and primary cancer cell lines. BMC Med Genomics. 2008 Oct 10;1:49.
• [25] Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
• [26] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [27] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [28] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [29] Eugenol causes melanoma growth suppression through inhibition of E2F1 transcriptional activity. J Biol Chem. 2005 Feb 18;280(7):5812-9. doi: 10.1074/jbc.M411429200. Epub 2004 Dec 1.
• [30] A high-throughput chemical screen reveals that harmine-mediated inhibition of DYRK1A increases human pancreatic beta cell replication. Nat Med. 2015 Apr;21(4):383-8. doi: 10.1038/nm.3820. Epub 2015 Mar 9.
• [31] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [32] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [33] Bisphenol A Exposure Changes the Transcriptomic and Proteomic Dynamics of Human Retinoblastoma Y79 Cells. Genes (Basel). 2021 Feb 11;12(2):264. doi: 10.3390/genes12020264.
• [34] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [35] Probiotic Bacillus subtilis CW14 reduces disruption of the epithelial barrier and toxicity of ochratoxin A to Caco-2?cells. Food Chem Toxicol. 2019 Apr;126:25-33. doi: 10.1016/j.fct.2019.02.009. Epub 2019 Feb 11.
• [36] System analysis of cross-talk between nuclear receptors reveals an opposite regulation of the cell cycle by LXR and FXR in human HepaRG liver cells. PLoS One. 2019 Aug 22;14(8):e0220894. doi: 10.1371/journal.pone.0220894. eCollection 2019.
• [37] Suppression of breast cancer by chemical modulation of vulnerable zinc fingers in estrogen receptor. Nat Med. 2004 Jan;10(1):40-7. doi: 10.1038/nm969. Epub 2003 Dec 14.