Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTU4XDEG)

• DOT Name: Plectin (PLEC)
• Synonyms: PCN; PLTN; Hemidesmosomal protein 1; HD1; Plectin-1
• Gene Name: PLEC
• Related Disease:
  Advanced cancer
  Amyotrophic lateral sclerosis
  Pancreatic cancer
  Acute myelogenous leukaemia
  Adenocarcinoma
  Adenoma
  Adult glioblastoma
  Astrocytoma
  Atrial fibrillation
  Autosomal recessive limb-girdle muscular dystrophy type 2Q
  Bullous pemphigoid
  Cardiomyopathy
  Congenital myasthenic syndrome
  Epidermolysis bullosa simplex
  Epidermolysis bullosa simplex 5B, with muscular dystrophy
  Epidermolysis bullosa simplex 5C, with pyloric atresia
  Epidermolysis bullosa simplex with nail dystrophy
  Epithelial ovarian cancer
  Glioblastoma multiforme
  Head-neck squamous cell carcinoma
  Hepatocellular carcinoma
  Immunodeficiency
  LambertEaton myasthenic syndrome
  Limb-girdle muscular dystrophy
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Matthew-Wood syndrome
  Medulloblastoma
  Muscular dystrophy
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Pancreatic ductal carcinoma
  Pancreatic tumour
  Pidermolysis bullosa simplex 5A, Ogna type
  Schizophrenia
  Autosomal recessive limb-girdle muscular dystrophy
  Aplasia cutis congenita
  Carcinoma of liver and intrahepatic biliary tract
  Epidermolysis bullosa
  Liver cancer
  Melanoma
  Myopathy
  Osteoarthritis
  Skin disease
  Squamous cell carcinoma
• UniProt ID: PLEC_HUMAN
• PDB ID: 1MB8; 2N03; 2ODU; 2ODV; 3F7P; 3PDY; 3PE0; 4GDO; 4Q58; 4Q59; 5J1F; 5J1G; 5J1H; 5J1I
• Pfam ID: PF00307 ; PF00681 ; PF03501 ; PF17902 ; PF18373 ; PF21019 ; PF21020 ; PF21097
• Sequence:
  MVAGMLMPRDQLRAIYEVLFREGVMVAKKDRRPRSLHPHVPGVTNLQVMRAMASLRARGL
  VRETFAWCHFYWYLTNEGIAHLRQYLHLPPEIVPASLQRVRRPVAMVMPARRTPHVQAVQ
  GPLGSPPKRGPLPTEEQRVYRRKELEEVSPETPVVPATTQRTLARPGPEPAPATDERDRV
  QKKTFTKWVNKHLIKAQRHISDLYEDLRDGHNLISLLEVLSGDSLPREKGRMRFHKLQNV
  QIALDYLRHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVSGQSEDMTAKEK
  LLLWSQRMVEGYQGLRCDNFTSSWRDGRLFNAIIHRHKPLLIDMNKVYRQTNLENLDQAF
  SVAERDLGVTRLLDPEDVDVPQPDEKSIITYVSSLYDAMPRVPDVQDGVRANELQLRWQE
  YRELVLLLLQWMRHHTAAFEERRFPSSFEEIEILWSQFLKFKEMELPAKEADKNRSKGIY
  QSLEGAVQAGQLKVPPGYHPLDVEKEWGKLHVAILEREKQLRSEFERLECLQRIVTKLQM
  EAGLCEEQLNQADALLQSDVRLLAAGKVPQRAGEVERDLDKADSMIRLLFNDVQTLKDGR
  HPQGEQMYRRVYRLHERLVAIRTEYNLRLKAGVAAPATQVAQVTLQSVQRRPELEDSTLR
  YLQDLLAWVEENQHRVDGAEWGVDLPSVEAQLGSHRGLHQSIEEFRAKIERARSDEGQLS
  PATRGAYRDCLGRLDLQYAKLLNSSKARLRSLESLHSFVAAATKELMWLNEKEEEEVGFD
  WSDRNTNMTAKKESYSALMRELELKEKKIKELQNAGDRLLREDHPARPTVESFQAALQTQ
  WSWMLQLCCCIEAHLKENAAYFQFFSDVREAEGQLQKLQEALRRKYSCDRSATVTRLEDL
  LQDAQDEKEQLNEYKGHLSGLAKRAKAVVQLKPRHPAHPMRGRLPLLAVCDYKQVEVTVH
  KGDECQLVGPAQPSHWKVLSSSGSEAAVPSVCFLVPPPNQEAQEAVTRLEAQHQALVTLW
  HQLHVDMKSLLAWQSLRRDVQLIRSWSLATFRTLKPEEQRQALHSLELHYQAFLRDSQDA
  GGFGPEDRLMAEREYGSCSHHYQQLLQSLEQGAQEESRCQRCISELKDIRLQLEACETRT
  VHRLRLPLDKEPARECAQRIAEQQKAQAEVEGLGKGVARLSAEAEKVLALPEPSPAAPTL
  RSELELTLGKLEQVRSLSAIYLEKLKTISLVIRGTQGAEEVLRAHEEQLKEAQAVPATLP
  ELEATKASLKKLRAQAEAQQPTFDALRDELRGAQEVGERLQQRHGERDVEVERWRERVAQ
  LLERWQAVLAQTDVRQRELEQLGRQLRYYRESADPLGAWLQDARRRQEQIQAMPLADSQA
  VREQLRQEQALLEEIERHGEKVEECQRFAKQYINAIKDYELQLVTYKAQLEPVASPAKKP
  KVQSGSESVIQEYVDLRTHYSELTTLTSQYIKFISETLRRMEEEERLAEQQRAEERERLA
  EVEAALEKQRQLAEAHAQAKAQAEREAKELQQRMQEEVVRREEAAVDAQQQKRSIQEELQ
  QLRQSSEAEIQAKARQAEAAERSRLRIEEEIRVVRLQLEATERQRGGAEGELQALRARAE
  EAEAQKRQAQEEAERLRRQVQDESQRKRQAEVELASRVKAEAEAAREKQRALQALEELRL
  QAEEAERRLRQAEVERARQVQVALETAQRSAEAELQSKRASFAEKTAQLERSLQEEHVAV
  AQLREEAERRAQQQAEAERAREEAERELERWQLKANEALRLRLQAEEVAQQKSLAQAEAE
  KQKEEAEREARRRGKAEEQAVRQRELAEQELEKQRQLAEGTAQQRLAAEQELIRLRAETE
  QGEQQRQLLEEELARLQREAAAATQKRQELEAELAKVRAEMEVLLASKARAEEESRSTSE
  KSKQRLEAEAGRFRELAEEAARLRALAEEAKRQRQLAEEDAARQRAEAERVLAEKLAAIG
  EATRLKTEAEIALKEKEAENERLRRLAEDEAFQRRRLEEQAAQHKADIEERLAQLRKASD
  SELERQKGLVEDTLRQRRQVEEEILALKASFEKAAAGKAELELELGRIRSNAEDTLRSKE
  QAELEAARQRQLAAEEERRRREAEERVQKSLAAEEEAARQRKAALEEVERLKAKVEEARR
  LRERAEQESARQLQLAQEAAQKRLQAEEKAHAFAVQQKEQELQQTLQQEQSVLDQLRGEA
  EAARRAAEEAEEARVQAEREAAQSRRQVEEAERLKQSAEEQAQARAQAQAAAEKLRKEAE
  QEAARRAQAEQAALRQKQAADAEMEKHKKFAEQTLRQKAQVEQELTTLRLQLEETDHQKN
  LLDEELQRLKAEATEAARQRSQVEEELFSVRVQMEELSKLKARIEAENRALILRDKDNTQ
  RFLQEEAEKMKQVAEEAARLSVAAQEAARLRQLAEEDLAQQRALAEKMLKEKMQAVQEAT
  RLKAEAELLQQQKELAQEQARRLQEDKEQMAQQLAEETQGFQRTLEAERQRQLEMSAEAE
  RLKLRVAEMSRAQARAEEDAQRFRKQAEEIGEKLHRTELATQEKVTLVQTLEIQRQQSDH
  DAERLREAIAELEREKEKLQQEAKLLQLKSEEMQTVQQEQLLQETQALQQSFLSEKDSLL
  QRERFIEQEKAKLEQLFQDEVAKAQQLREEQQRQQQQMEQERQRLVASMEEARRRQHEAE
  EGVRRKQEELQQLEQQRRQQEELLAEENQRLREQLQLLEEQHRAALAHSEEVTASQVAAT
  KTLPNGRDALDGPAAEAEPEHSFDGLRRKVSAQRLQEAGILSAEELQRLAQGHTTVDELA
  RREDVRHYLQGRSSIAGLLLKATNEKLSVYAALQRQLLSPGTALILLEAQAASGFLLDPV
  RNRRLTVNEAVKEGVVGPELHHKLLSAERAVTGYKDPYTGQQISLFQAMQKGLIVREHGI
  RLLEAQIATGGVIDPVHSHRVPVDVAYRRGYFDEEMNRVLADPSDDTKGFFDPNTHENLT
  YLQLLERCVEDPETGLCLLPLTDKAAKGGELVYTDSEARDVFEKATVSAPFGKFQGKTVT
  IWEIINSEYFTAEQRRDLLRQFRTGRITVEKIIKIIITVVEEQEQKGRLCFEGLRSLVPA
  AELLESRVIDRELYQQLQRGERSVRDVAEVDTVRRALRGANVIAGVWLEEAGQKLSIYNA
  LKKDLLPSDMAVALLEAQAGTGHIIDPATSARLTVDEAVRAGLVGPEFHEKLLSAEKAVT
  GYRDPYTGQSVSLFQALKKGLIPREQGLRLLDAQLSTGGIVDPSKSHRVPLDVACARGCL
  DEETSRALSAPRADAKAYSDPSTGEPATYGELQQRCRPDQLTGLSLLPLSEKAARARQEE
  LYSELQARETFEKTPVEVPVGGFKGRTVTVWELISSEYFTAEQRQELLRQFRTGKVTVEK
  VIKILITIVEEVETLRQERLSFSGLRAPVPASELLASGVLSRAQFEQLKDGKTTVKDLSE
  LGSVRTLLQGSGCLAGIYLEDTKEKVSIYEAMRRGLLRATTAALLLEAQAATGFLVDPVR
  NQRLYVHEAVKAGVVGPELHEQLLSAEKAVTGYRDPYSGSTISLFQAMQKGLVLRQHGIR
  LLEAQIATGGIIDPVHSHRVPVDVAYQRGYFSEEMNRVLADPSDDTKGFFDPNTHENLTY
  RQLLERCVEDPETGLRLLPLKGAEKAEVVETTQVYTEEETRRAFEETQIDIPGGGSHGGS
  TMSLWEVMQSDLIPEEQRAQLMADFQAGRVTKERMIIIIIEIIEKTEIIRQQGLASYDYV
  RRRLTAEDLFEARIISLETYNLLREGTRSLREALEAESAWCYLYGTGSVAGVYLPGSRQT
  LSIYQALKKGLLSAEVARLLLEAQAATGFLLDPVKGERLTVDEAVRKGLVGPELHDRLLS
  AERAVTGYRDPYTEQTISLFQAMKKELIPTEEALRLLDAQLATGGIVDPRLGFHLPLEVA
  YQRGYLNKDTHDQLSEPSEVRSYVDPSTDERLSYTQLLRRCRRDDGTGQLLLPLSDARKL
  TFRGLRKQITMEELVRSQVMDEATALQLREGLTSIEEVTKNLQKFLEGTSCIAGVFVDAT
  KERLSVYQAMKKGIIRPGTAFELLEAQAATGYVIDPIKGLKLTVEEAVRMGIVGPEFKDK
  LLSAERAVTGYKDPYSGKLISLFQAMKKGLILKDHGIRLLEAQIATGGIIDPEESHRLPV
  EVAYKRGLFDEEMNEILTDPSDDTKGFFDPNTEENLTYLQLMERCITDPQTGLCLLPLKE
  KKRERKTSSKSSVRKRRVVIVDPETGKEMSVYEAYRKGLIDHQTYLELSEQECEWEEITI
  SSSDGVVKSMIIDRRSGRQYDIDDAIAKNLIDRSALDQYRAGTLSITEFADMLSGNAGGF
  RSRSSSVGSSSSYPISPAVSRTQLASWSDPTEETGPVAGILDTETLEKVSITEAMHRNLV
  DNITGQRLLEAQACTGGIIDPSTGERFPVTDAVNKGLVDKIMVDRINLAQKAFCGFEDPR
  TKTKMSAAQALKKGWLYYEAGQRFLEVQYLTGGLIEPDTPGRVPLDEALQRGTVDARTAQ
  KLRDVGAYSKYLTCPKTKLKISYKDALDRSMVEEGTGLRLLEAAAQSTKGYYSPYSVSGS
  GSTAGSRTGSRTGSRAGSRRGSFDATGSGFSMTFSSSSYSSSGYGRRYASGSSASLGGPE
  SAVA
• Function: Interlinks intermediate filaments with microtubules and microfilaments and anchors intermediate filaments to desmosomes or hemidesmosomes. Could also bind muscle proteins such as actin to membrane complexes in muscle. May be involved not only in the filaments network, but also in the regulation of their dynamics. Structural component of muscle. Isoform 9 plays a major role in the maintenance of myofiber integrity.
• Tissue Specificity: Widely expressed with highest levels in muscle, heart, placenta and spinal cord.
• KEGG Pathway: Cytoskeleton in muscle cells (hsa04820)
• Reactome Pathway:
  Caspase-mediated cleavage of cytoskeletal proteins (R-HSA-264870)
  Type I hemidesmosome assembly (R-HSA-446107)
  Assembly of collagen fibrils and other multimeric structures (R-HSA-2022090)

Molecular Interaction Atlas (MIA) of This DOT

47 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Definitive	Biomarker	[1]
Amyotrophic lateral sclerosis	DISF7HVM	Definitive	Biomarker	[2]
Pancreatic cancer	DISJC981	Definitive	Biomarker	[3]
Acute myelogenous leukaemia	DISCSPTN	Strong	Biomarker	[4]
Adenocarcinoma	DIS3IHTY	Strong	Altered Expression	[5]
Adenoma	DIS78ZEV	Strong	Altered Expression	[5]
Adult glioblastoma	DISVP4LU	Strong	Biomarker	[6]
Astrocytoma	DISL3V18	Strong	Altered Expression	[7]
Atrial fibrillation	DIS15W6U	Strong	Genetic Variation	[8]
Autosomal recessive limb-girdle muscular dystrophy type 2Q	DIS690P3	Strong	Autosomal recessive	[9]
Bullous pemphigoid	DISOJLKV	Strong	Biomarker	[10]
Cardiomyopathy	DISUPZRG	Strong	Genetic Variation	[11]
Congenital myasthenic syndrome	DISJLG2T	Strong	Autosomal recessive	[12]
Epidermolysis bullosa simplex	DIS2CZ6X	Strong	Biomarker	[13]
Epidermolysis bullosa simplex 5B, with muscular dystrophy	DIS739SC	Strong	Autosomal recessive	[12]
Epidermolysis bullosa simplex 5C, with pyloric atresia	DIS15AFN	Strong	Autosomal recessive	[12]
Epidermolysis bullosa simplex with nail dystrophy	DIS2PCPO	Strong	Autosomal recessive	[14]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[15]
Glioblastoma multiforme	DISK8246	Strong	Biomarker	[6]
Head-neck squamous cell carcinoma	DISF7P24	Strong	Biomarker	[16]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[17]
Immunodeficiency	DIS093I0	Strong	Altered Expression	[18]
LambertEaton myasthenic syndrome	DISN0Q7Q	Strong	Biomarker	[19]
Limb-girdle muscular dystrophy	DISI9Y1Z	Strong	Genetic Variation	[20]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[21]
Lung cancer	DISCM4YA	Strong	Biomarker	[21]
Lung carcinoma	DISTR26C	Strong	Biomarker	[21]
Matthew-Wood syndrome	DISA7HR7	Strong	Biomarker	[22]
Medulloblastoma	DISZD2ZL	Strong	Biomarker	[23]
Muscular dystrophy	DISJD6P7	Strong	Biomarker	[13]
Neoplasm	DISZKGEW	Strong	Biomarker	[24]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[15]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[15]
Pancreatic ductal carcinoma	DIS26F9Q	Strong	Altered Expression	[25]
Pancreatic tumour	DIS3U0LK	Strong	Biomarker	[26]
Pidermolysis bullosa simplex 5A, Ogna type	DISSN0G8	Strong	Autosomal dominant	[12]
Schizophrenia	DISSRV2N	Strong	Altered Expression	[27]
Autosomal recessive limb-girdle muscular dystrophy	DISWPGLM	Moderate	Autosomal recessive	[28]
Aplasia cutis congenita	DISMDAYM	Supportive	Autosomal dominant	[29]
Carcinoma of liver and intrahepatic biliary tract	DIS8WA0W	Limited	Biomarker	[17]
Epidermolysis bullosa	DISVOTZQ	Limited	Biomarker	[13]
Liver cancer	DISDE4BI	Limited	Biomarker	[17]
Melanoma	DIS1RRCY	Limited	Biomarker	[30]
Myopathy	DISOWG27	Limited	Biomarker	[31]
Osteoarthritis	DIS05URM	Limited	Biomarker	[32]
Skin disease	DISDW8R6	Limited	Genetic Variation	[33]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[34]

6 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Plectin (PLEC).	[35]
Triclosan	DMZUR4N	Approved	Triclosan increases the methylation of Plectin (PLEC).	[47]
Fulvestrant	DM0YZC6	Approved	Fulvestrant increases the methylation of Plectin (PLEC).	[51]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Plectin (PLEC).	[58]
Coumarin	DM0N8ZM	Investigative	Coumarin affects the phosphorylation of Plectin (PLEC).	[61]
Hexadecanoic acid	DMWUXDZ	Investigative	Hexadecanoic acid decreases the phosphorylation of Plectin (PLEC).	[62]

26 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Plectin (PLEC).	[36]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Plectin (PLEC).	[37]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Plectin (PLEC).	[38]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Plectin (PLEC).	[39]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Plectin (PLEC).	[40]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Plectin (PLEC).	[41]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Plectin (PLEC).	[42]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Plectin (PLEC).	[43]
Arsenic	DMTL2Y1	Approved	Arsenic increases the expression of Plectin (PLEC).	[44]
Quercetin	DM3NC4M	Approved	Quercetin increases the expression of Plectin (PLEC).	[45]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Plectin (PLEC).	[46]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Plectin (PLEC).	[48]
Selenium	DM25CGV	Approved	Selenium increases the expression of Plectin (PLEC).	[49]
Progesterone	DMUY35B	Approved	Progesterone decreases the expression of Plectin (PLEC).	[50]
Niclosamide	DMJAGXQ	Approved	Niclosamide increases the expression of Plectin (PLEC).	[52]
Cannabidiol	DM0659E	Approved	Cannabidiol decreases the expression of Plectin (PLEC).	[53]
Troglitazone	DM3VFPD	Approved	Troglitazone increases the expression of Plectin (PLEC).	[54]
Cidofovir	DMA13GD	Approved	Cidofovir decreases the expression of Plectin (PLEC).	[48]
Clodronate	DM9Y6X7	Approved	Clodronate decreases the expression of Plectin (PLEC).	[48]
Ibuprofen	DM8VCBE	Approved	Ibuprofen increases the expression of Plectin (PLEC).	[55]
Adefovir dipivoxil	DMMAWY1	Approved	Adefovir dipivoxil increases the expression of Plectin (PLEC).	[48]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Plectin (PLEC).	[56]
Epigallocatechin gallate	DMCGWBJ	Phase 3	Epigallocatechin gallate decreases the expression of Plectin (PLEC).	[57]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Plectin (PLEC).	[42]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the expression of Plectin (PLEC).	[59]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Plectin (PLEC).	[60]

References

• [1] Zirconium-Porphyrin PCN-222: pH-responsive Controlled Anticancer Drug Oridonin.Evid Based Complement Alternat Med. 2018 Dec 4;2018:3249023. doi: 10.1155/2018/3249023. eCollection 2018.
• [2] Combined Tissue-Fluid Proteomics to Unravel Phenotypic Variability in Amyotrophic Lateral Sclerosis.Sci Rep. 2019 Mar 14;9(1):4478. doi: 10.1038/s41598-019-40632-4.
• [3] Plectin-1 Targeted Dual-modality Nanoparticles for Pancreatic Cancer Imaging.EBioMedicine. 2018 Apr;30:129-137. doi: 10.1016/j.ebiom.2018.03.008. Epub 2018 Mar 15.
• [4] Molecular alterations in bone marrow mesenchymal stromal cells derived from acute myeloid leukemia patients.Leukemia. 2017 May;31(5):1069-1078. doi: 10.1038/leu.2016.324. Epub 2016 Nov 11.
• [5] An early evaluation of malignant tendency with plectin expression in human colorectal adenoma and adenocarcinoma.J Med. 2004;35(1-6):141-9.
• [6] The hyaluronan receptor RHAMM/IHABP in astrocytoma cells: expression of a tumor-specific variant and association with microtubules.J Neurooncol. 2002 Aug;59(1):15-26. doi: 10.1023/a:1016373015569.
• [7] Plectin regulates the organization of glial fibrillary acidic protein in Alexander disease.Am J Pathol. 2006 Mar;168(3):888-97. doi: 10.2353/ajpath.2006.051028.
• [8] A Missense Variant in PLEC Increases Riskof Atrial Fibrillation.J Am Coll Cardiol. 2017 Oct 24;70(17):2157-2168. doi: 10.1016/j.jacc.2017.09.005.
• [9] Clinical heterogeneity in epidermolysis bullosa simplex with plectin (PLEC) mutations-A study of six unrelated families from India. Am J Med Genet A. 2022 Aug;188(8):2454-2459. doi: 10.1002/ajmg.a.62781. Epub 2022 May 17.
• [10] Structural proteins of the dermal-epidermal junction targeted by autoantibodies in pemphigoid diseases.Exp Dermatol. 2017 Dec;26(12):1154-1162. doi: 10.1111/exd.13446.
• [11] Downstream effects of plectin mutations in epidermolysis bullosa simplex with muscular dystrophy.Acta Neuropathol Commun. 2016 Apr 27;4(1):44. doi: 10.1186/s40478-016-0314-7.
• [12] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [13] Laryngeal lesion associated with epidermolysis bullosa secondary to congenital plectin deficiency.Eur Ann Otorhinolaryngol Head Neck Dis. 2019 Jun;136(3):203-205. doi: 10.1016/j.anorl.2019.02.009. Epub 2019 Mar 15.
• [14] PanelApp crowdsources expert knowledge to establish consensus diagnostic gene panels. Nat Genet. 2019 Nov;51(11):1560-1565. doi: 10.1038/s41588-019-0528-2.
• [15] Multifunctional nanoparticles for co-delivery of paclitaxel and carboplatin against ovarian cancer by inactivating the JMJD3-HER2 axis.Nanoscale. 2017 Sep 14;9(35):13142-13152. doi: 10.1039/c7nr04473a.
• [16] Plectin promotes migration and invasion of cancer cells and is a novel prognostic marker for head and neck squamous cell carcinoma.J Proteomics. 2012 Mar 16;75(6):1803-15. doi: 10.1016/j.jprot.2011.12.018. Epub 2011 Dec 30.
• [17] Plectin deficiency in liver cancer cells promotes cell migration and sensitivity to sorafenib treatment.Cell Adh Migr. 2018 Jan 2;12(1):19-27. doi: 10.1080/19336918.2017.1288789. Epub 2017 Feb 17.
• [18] Unexpected gain of function for the scaffolding protein plectin due to mislocalization in pancreatic cancer.Proc Natl Acad Sci U S A. 2013 Nov 26;110(48):19414-9. doi: 10.1073/pnas.1309720110. Epub 2013 Nov 11.
• [19] Loss-of-function mutations in CAST cause peeling skin, leukonychia, acral punctate keratoses, cheilitis, and knuckle pads. Am J Hum Genet. 2015 Mar 5;96(3):440-7. doi: 10.1016/j.ajhg.2014.12.026. Epub 2015 Feb 12.
• [20] Novel compound heterozygous PLEC mutations lead to earlyonset limbgirdle muscular dystrophy 2Q.Mol Med Rep. 2017 May;15(5):2760-2764. doi: 10.3892/mmr.2017.6309. Epub 2017 Mar 9.
• [21] Unbiased peptoid combinatorial cell screen identifies plectin protein as a potential biomarker for lung cancer stem cells.Sci Rep. 2019 Oct 18;9(1):14954. doi: 10.1038/s41598-019-51004-3.
• [22] Delivery of miR-212 by chimeric peptide-condensed supramolecular nanoparticles enhances the sensitivity of pancreatic ductal adenocarcinoma to doxorubicin.Biomaterials. 2019 Feb;192:590-600. doi: 10.1016/j.biomaterials.2018.11.035. Epub 2018 Nov 30.
• [23] Human D3 dopamine receptor in the medulloblastoma TE671 cell line: cross-talk between D1 and D3 receptors.FEBS Lett. 1998 Nov 13;439(1-2):138-42. doi: 10.1016/s0014-5793(98)01356-8.
• [24] Mn-Porphyrin-Based Metal-Organic Framework with High Longitudinal Relaxivity for Magnetic Resonance Imaging Guidance and Oxygen Self-Supplementing Photodynamic Therapy.ACS Appl Mater Interfaces. 2019 Nov 13;11(45):41946-41956. doi: 10.1021/acsami.9b15083. Epub 2019 Oct 29.
• [25] Multifaceted peptide assisted one-pot synthesis of gold nanoparticles for plectin-1 targeted gemcitabine delivery in pancreatic cancer.Nanoscale. 2017 Oct 19;9(40):15622-15634. doi: 10.1039/c7nr03172f.
• [26] Development of a Tumor-Responsive Nanopolyplex Targeting Pancreatic Cancer Cells and Stroma.ACS Appl Mater Interfaces. 2019 Dec 11;11(49):45390-45403. doi: 10.1021/acsami.9b15116. Epub 2019 Nov 26.
• [27] Prefrontal cortex shotgun proteome analysis reveals altered calcium homeostasis and immune system imbalance in schizophrenia.Eur Arch Psychiatry Clin Neurosci. 2009 Apr;259(3):151-63. doi: 10.1007/s00406-008-0847-2. Epub 2009 Jan 22.
• [28] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [29] Widespread aplasia cutis congenita in sibs with PLEC1 and ITGB4 variants. Am J Med Genet A. 2019 Aug;179(8):1547-1555. doi: 10.1002/ajmg.a.61260. Epub 2019 Jun 11.
• [30] An Organoruthenium Anticancer Agent Shows Unexpected Target Selectivity For Plectin.Angew Chem Int Ed Engl. 2017 Jul 3;56(28):8267-8271. doi: 10.1002/anie.201702242. Epub 2017 May 26.
• [31] Targeted inactivation of plectin reveals essential function in maintaining the integrity of skin, muscle, and heart cytoarchitecture.Genes Dev. 1997 Dec 1;11(23):3143-56. doi: 10.1101/gad.11.23.3143.
• [32] Prioritization of PLEC and GRINA as Osteoarthritis Risk Genes Through the Identification and Characterization of Novel Methylation Quantitative Trait Loci.Arthritis Rheumatol. 2019 Aug;71(8):1285-1296. doi: 10.1002/art.40849. Epub 2019 Jun 27.
• [33] Profound immunodeficiency with severe skin disease explained by concomitant novel CARMIL2 and PLEC1 loss-of-function mutations.Clin Immunol. 2019 Nov;208:108228. doi: 10.1016/j.clim.2019.06.004. Epub 2019 Jun 10.
• [34] Putative biomarkers of malignant transformation of sinonasal inverted papilloma into squamous cell carcinoma.J Int Med Res. 2019 Jun;47(6):2371-2380. doi: 10.1177/0300060519838385. Epub 2019 Apr 16.
• [35] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [36] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [37] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [38] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [39] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [40] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [41] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [42] Changes in gene expressions elicited by physiological concentrations of genistein on human endometrial cancer cells. Mol Carcinog. 2006 Oct;45(10):752-63.
• [43] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [44] Nucleophosmin in the pathogenesis of arsenic-related bladder carcinogenesis revealed by quantitative proteomics. Toxicol Appl Pharmacol. 2010 Jan 15;242(2):126-35. doi: 10.1016/j.taap.2009.09.016. Epub 2009 Oct 7.
• [45] Identification of biomarkers for the initiation of apoptosis in human preneoplastic colonocytes by proteome analysis. Int J Cancer. 2004 Mar 20;109(2):220-9. doi: 10.1002/ijc.11692.
• [46] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [47] Pregnancy exposure to synthetic phenols and placental DNA methylation - An epigenome-wide association study in male infants from the EDEN cohort. Environ Pollut. 2021 Dec 1;290:118024. doi: 10.1016/j.envpol.2021.118024. Epub 2021 Aug 21.
• [48] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [49] Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
• [50] Gene expression in endometrial cancer cells (Ishikawa) after short time high dose exposure to progesterone. Steroids. 2008 Jan;73(1):116-28.
• [51] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [52] Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
• [53] Cannabidiol Displays Proteomic Similarities to Antipsychotics in Cuprizone-Exposed Human Oligodendrocytic Cell Line MO3.13. Front Mol Neurosci. 2021 May 28;14:673144. doi: 10.3389/fnmol.2021.673144. eCollection 2021.
• [54] Effects of ciglitazone and troglitazone on the proliferation of human stomach cancer cells. World J Gastroenterol. 2009 Jan 21;15(3):310-20.
• [55] Protein profile in neuroblastoma cells incubated with S- and R-enantiomers of ibuprofen by iTRAQ-coupled 2-D LC-MS/MS analysis: possible action of induced proteins on Alzheimer's disease. Proteomics. 2008 Apr;8(8):1595-607. doi: 10.1002/pmic.200700556.
• [56] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [57] Application of the adverse outcome pathway concept for investigating developmental neurotoxicity potential of Chinese herbal medicines by using human neural progenitor cells in vitro. Cell Biol Toxicol. 2023 Feb;39(1):319-343. doi: 10.1007/s10565-022-09730-4. Epub 2022 Jun 15.
• [58] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [59] Comparative proteomics reveals concordant and discordant biochemical effects of caffeine versus epigallocatechin-3-gallate in human endothelial cells. Toxicol Appl Pharmacol. 2019 Sep 1;378:114621. doi: 10.1016/j.taap.2019.114621. Epub 2019 Jun 10.
• [60] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.
• [61] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [62] Functional lipidomics: Palmitic acid impairs hepatocellular carcinoma development by modulating membrane fluidity and glucose metabolism. Hepatology. 2017 Aug;66(2):432-448. doi: 10.1002/hep.29033. Epub 2017 Jun 16.