Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTUM02FW)

DOT Name Arginine/serine-rich protein PNISR (PNISR)
Synonyms
PNN-interacting serine/arginine-rich protein; SR-related protein; SR-rich protein; Serine/arginine-rich-splicing regulatory protein 130; SRrp130; Splicing factor, arginine/serine-rich 130; Splicing factor, arginine/serine-rich 18
Gene Name PNISR
Related Disease
Psoriasis ( )
UniProt ID
PNISR_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF15996
Sequence
MWDQGGQPWQQWPLNQQQWMQSFQHQQDPSQIDWAALAQAWIAQREASGQQSMVEQPPGM
MPNGQDMSTMESGPNNHGNFQGDSNFNRMWQPEWGMHQQPPHPPPDQPWMPPTPGPMDIV
PPSEDSNSQDSGEFAPDNRHIFNQNNHNFGGPPDNFAVGPVNQFDYQHGAAFGPPQGGFH
PPYWQPGPPGPPAPPQNRRERPSSFRDRQRSPIALPVKQEPPQIDAVKRRTLPAWIREGL
EKMEREKQKKLEKERMEQQRSQLSKKEKKATEDAEGGDGPRLPQRSKFDSDEEEEDTENV
EAASSGKVTRSPSPVPQEEHSDPEMTEEEKEYQMMLLTKMLLTEILLDVTDEEIYYVAKD
AHRKATKAPAKQLAQSSALASLTGLGGLGGYGSGDSEDERSDRGSESSDTDDEELRHRIR
QKQEAFWRKEKEQQLLHDKQMEEEKQQTERVTKEMNEFIHKEQNSLSLLEAREADGDVVN
EKKRTPNETTSVLEPKKEHKEKEKQGRSRSGSSSSGSSSSNSRTSSTSSTVSSSSYSSSS
GSSRTSSRSSSPKRKKRHSRSRSPTIKARRSRSRSYSRRIKIESNRARVKIRDRRRSNRN
SIERERRRNRSPSRERRRSRSRSRDRRTNRASRSRSRDRRKIDDQRGNLSGNSHKHKGEA
KEQERKKERSRSIDKDRKKKDKEREREQDKRKEKQKREEKDFKFSSQDDRLKRKRESERT
FSRSGSISVKIIRHDSRQDSKKSTTKDSKKHSGSDSSGRSSSESPGSSKEKKAKKPKHSR
SRSVEKSQRSGKKASRKHKSKSRSR
Tissue Specificity Expressed in heart, skeletal muscle, thymus, spleen, kidney, liver, placenta and leukocytes.

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Psoriasis DIS59VMN Strong Biomarker [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
21 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [2]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [4]
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of Arginine/serine-rich protein PNISR (PNISR). [5]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Arginine/serine-rich protein PNISR (PNISR). [6]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [7]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [8]
Vorinostat DMWMPD4 Approved Vorinostat decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [9]
Marinol DM70IK5 Approved Marinol increases the expression of Arginine/serine-rich protein PNISR (PNISR). [10]
Selenium DM25CGV Approved Selenium decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [11]
Bortezomib DMNO38U Approved Bortezomib increases the expression of Arginine/serine-rich protein PNISR (PNISR). [12]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Arginine/serine-rich protein PNISR (PNISR). [13]
SNDX-275 DMH7W9X Phase 3 SNDX-275 decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [9]
Tocopherol DMBIJZ6 Phase 2 Tocopherol decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [11]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [17]
Trichostatin A DM9C8NX Investigative Trichostatin A affects the expression of Arginine/serine-rich protein PNISR (PNISR). [18]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [19]
Nickel chloride DMI12Y8 Investigative Nickel chloride decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [20]
Resorcinol DMM37C0 Investigative Resorcinol increases the expression of Arginine/serine-rich protein PNISR (PNISR). [21]
Microcystin-LR DMTMLRN Investigative Microcystin-LR decreases the expression of Arginine/serine-rich protein PNISR (PNISR). [22]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
TAK-243 DM4GKV2 Phase 1 TAK-243 decreases the sumoylation of Arginine/serine-rich protein PNISR (PNISR). [15]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Arginine/serine-rich protein PNISR (PNISR). [16]
------------------------------------------------------------------------------------

References

1 Splicing factors differentially expressed in psoriasis alter mRNA maturation of disease-associated EDA+fibronectin.Mol Cell Biochem. 2017 Dec;436(1-2):189-199. doi: 10.1007/s11010-017-3090-1. Epub 2017 Jun 6.
2 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
3 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
4 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
7 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
8 Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
9 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
10 Delta9-tetrahydrocannabinol inhibits cytotrophoblast cell proliferation and modulates gene transcription. Mol Hum Reprod. 2006 May;12(5):321-33. doi: 10.1093/molehr/gal036. Epub 2006 Apr 5.
11 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
12 The proapoptotic effect of zoledronic acid is independent of either the bone microenvironment or the intrinsic resistance to bortezomib of myeloma cells and is enhanced by the combination with arsenic trioxide. Exp Hematol. 2011 Jan;39(1):55-65.
13 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
14 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
15 Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
16 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
17 Isobaric tags for relative and absolute quantitation-based proteomics analysis of the effect of ginger oil on bisphenol A-induced breast cancer cell proliferation. Oncol Lett. 2021 Feb;21(2):101. doi: 10.3892/ol.2020.12362. Epub 2020 Dec 8.
18 A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
19 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.
20 The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
21 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
22 Cytotoxic Effects of Environmental Toxins on Human Glial Cells. Neurotox Res. 2017 Feb;31(2):245-258. doi: 10.1007/s12640-016-9678-5. Epub 2016 Oct 29.