Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTWKS9MF)

DOT Name Mucin-13 (MUC13)
Synonyms MUC-13; Down-regulated in colon cancer 1
Gene Name MUC13
Related Disease
Inflammatory bowel disease ( )
Advanced cancer ( )
Clear cell renal carcinoma ( )
Colon cancer ( )
Colon carcinoma ( )
Colorectal neoplasm ( )
Epithelial ovarian cancer ( )
Esophageal squamous cell carcinoma ( )
Gastric cancer ( )
Intestinal neoplasm ( )
Intrahepatic cholangiocarcinoma ( )
Laryngitis ( )
Ovarian cancer ( )
Ovarian neoplasm ( )
Pancreatic cancer ( )
Pancreatic tumour ( )
Stomach cancer ( )
Adult glioblastoma ( )
Glioblastoma multiforme ( )
Renal cell carcinoma ( )
Crohn disease ( )
Ulcerative colitis ( )
Carcinoma ( )
Colitis ( )
Colorectal carcinoma ( )
Cutaneous melanoma ( )
Hepatocellular carcinoma ( )
Inflammation ( )
Ischemia ( )
Matthew-Wood syndrome ( )
Melanoma ( )
Metastatic malignant neoplasm ( )
Pancreatic ductal carcinoma ( )
Uveal Melanoma ( )
Vasculitis ( )
UniProt ID
MUC13_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF01390
Sequence
MKAIIHLTLLALLSVNTATNQGNSADAVTTTETATSGPTVAAADTTETNFPETASTTANT
PSFPTATSPAPPIISTHSSSTIPTPAPPIISTHSSSTIPIPTAADSESTTNVNSLATSDI
ITASSPNDGLITMVPSETQSNNEMSPTTEDNQSSGPPTGTALLETSTLNSTGPSNPCQDD
PCADNSLCVKLHNTSFCLCLEGYYYNSSTCKKGKVFPGKISVTVSETFDPEEKHSMAYQD
LHSEITSLFKDVFGTSVYGQTVILTVSTSLSPRSEMRADDKFVNVTIVTILAETTSDNEK
TVTEKINKAIRSSSSNFLNYDLTLRCDYYGCNQTADDCLNGLACDCKSDLQRPNPQSPFC
VASSLKCPDACNAQHKQCLIKKSGGAPECACVPGYQEDANGNCQKCAFGYSGLDCKDKFQ
LILTIVGTIAGIVILSMIIALIVTARSNNKTKHIEEENLIDEDFQNLKLRSTGFTNLGAE
GSVFPKVRITASRDSQMQNPYSRHSSMPRPDY
Function Epithelial and hemopoietic transmembrane mucin that may play a role in cell signaling.
Tissue Specificity
Highly expressed in epithelial tissues, particularly those of the gastrointestinal and respiratory tracts, such as large intestine and trachea, followed by kidney, small intestine, appendix and stomach.
Reactome Pathway
Defective C1GALT1C1 causes TNPS (R-HSA-5083632 )
Defective GALNT12 causes CRCS1 (R-HSA-5083636 )
Dectin-2 family (R-HSA-5621480 )
O-linked glycosylation of mucins (R-HSA-913709 )
RND3 GTPase cycle (R-HSA-9696264 )
RND2 GTPase cycle (R-HSA-9696270 )
RND1 GTPase cycle (R-HSA-9696273 )
Termination of O-glycan biosynthesis (R-HSA-977068 )
Defective GALNT3 causes HFTC (R-HSA-5083625 )

Molecular Interaction Atlas (MIA) of This DOT

35 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Inflammatory bowel disease DISGN23E Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [2]
Clear cell renal carcinoma DISBXRFJ Strong Altered Expression [3]
Colon cancer DISVC52G Strong Altered Expression [4]
Colon carcinoma DISJYKUO Strong Altered Expression [4]
Colorectal neoplasm DISR1UCN Strong Altered Expression [5]
Epithelial ovarian cancer DIS56MH2 Strong Posttranslational Modification [6]
Esophageal squamous cell carcinoma DIS5N2GV Strong Altered Expression [7]
Gastric cancer DISXGOUK Strong Altered Expression [8]
Intestinal neoplasm DISK0GUH Strong Altered Expression [9]
Intrahepatic cholangiocarcinoma DIS6GOC8 Strong Altered Expression [2]
Laryngitis DISX7UUD Strong Altered Expression [10]
Ovarian cancer DISZJHAP Strong Posttranslational Modification [6]
Ovarian neoplasm DISEAFTY Strong Posttranslational Modification [6]
Pancreatic cancer DISJC981 Strong Biomarker [11]
Pancreatic tumour DIS3U0LK Strong Biomarker [11]
Stomach cancer DISKIJSX Strong Altered Expression [8]
Adult glioblastoma DISVP4LU moderate Biomarker [12]
Glioblastoma multiforme DISK8246 moderate Biomarker [12]
Renal cell carcinoma DISQZ2X8 moderate Altered Expression [3]
Crohn disease DIS2C5Q8 Disputed Genetic Variation [13]
Ulcerative colitis DIS8K27O Disputed Genetic Variation [13]
Carcinoma DISH9F1N Limited Biomarker [1]
Colitis DISAF7DD Limited Biomarker [5]
Colorectal carcinoma DIS5PYL0 Limited Biomarker [5]
Cutaneous melanoma DIS3MMH9 Limited Biomarker [1]
Hepatocellular carcinoma DIS0J828 Limited Altered Expression [14]
Inflammation DISJUQ5T Limited Altered Expression [15]
Ischemia DIS5XOOY Limited Biomarker [16]
Matthew-Wood syndrome DISA7HR7 Limited Altered Expression [17]
Melanoma DIS1RRCY Limited Biomarker [1]
Metastatic malignant neoplasm DIS86UK6 Limited Biomarker [2]
Pancreatic ductal carcinoma DIS26F9Q Limited Altered Expression [17]
Uveal Melanoma DISA7ZGL Limited Biomarker [1]
Vasculitis DISQRKDX Limited Biomarker [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 35 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the methylation of Mucin-13 (MUC13). [18]
------------------------------------------------------------------------------------
5 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Mucin-13 (MUC13). [19]
Quercetin DM3NC4M Approved Quercetin increases the expression of Mucin-13 (MUC13). [20]
Troglitazone DM3VFPD Approved Troglitazone increases the expression of Mucin-13 (MUC13). [21]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the expression of Mucin-13 (MUC13). [22]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Mucin-13 (MUC13). [23]
------------------------------------------------------------------------------------

References

1 Exploring the potential of mucin 13 (MUC13) as a biomarker for carcinomas and other diseases.Clin Chem Lab Med. 2018 Oct 25;56(11):1945-1953. doi: 10.1515/cclm-2018-0139.
2 MUC13 promotes intrahepatic cholangiocarcinoma progression viaEGFR/PI3K/AKT pathways.J Hepatol. 2020 Apr;72(4):761-773. doi: 10.1016/j.jhep.2019.11.021. Epub 2019 Dec 16.
3 MUC13 overexpression in renal cell carcinoma plays a central role in tumor progression and drug resistance.Int J Cancer. 2017 May 15;140(10):2351-2363. doi: 10.1002/ijc.30651. Epub 2017 Feb 28.
4 Functions and regulation of MUC13 mucin in colon cancer cells.J Gastroenterol. 2014 Oct;49(10):1378-91. doi: 10.1007/s00535-013-0885-z. Epub 2013 Oct 7.
5 MUC13 promotes the development of colitis-associated colorectal tumors via -catenin activity.Oncogene. 2019 Nov;38(48):7294-7310. doi: 10.1038/s41388-019-0951-y. Epub 2019 Aug 19.
6 Overexpression of mucin 13 due to promoter methylation promotes aggressive behavior in ovarian cancer cells.Yonsei Med J. 2014 Sep;55(5):1206-13. doi: 10.3349/ymj.2014.55.5.1206.
7 The expression and prognostic significance of Mucin 13 and Mucin 20 in esophageal squamous cell carcinoma.J Cancer Res Ther. 2015 Aug;11 Suppl 1:C74-9. doi: 10.4103/0973-1482.163846.
8 Overexpression of MUC13 is associated with intestinal-type gastric cancer.Cancer Sci. 2005 May;96(5):265-73. doi: 10.1111/j.1349-7006.2005.00043.x.
9 High expression of Mucin13 associates with grimmer postoperative prognosis of patients with non-metastatic clear-cell renal cell carcinoma.Oncotarget. 2017 Jan 31;8(5):7548-7558. doi: 10.18632/oncotarget.13692.
10 Mucin gene expression in human laryngeal epithelia: effect of laryngopharyngeal reflux.Ann Otol Rhinol Laryngol. 2008 Sep;117(9):688-95. doi: 10.1177/000348940811700911.
11 MUC13 contributes to rewiring of glucose metabolism in pancreatic cancer.Oncogenesis. 2018 Feb 22;7(2):19. doi: 10.1038/s41389-018-0031-0.
12 Upstream stimulating factor1 (USF1) enhances the proliferation of glioblastoma stem cells mainly by activating the transcription of mucin13 (MUC13).Pharmazie. 2017 Feb 1;72(2):98-102. doi: 10.1691/ph.2017.6788.
13 Aberrant intestinal expression and allelic variants of mucin genes associated with inflammatory bowel disease.J Mol Med (Berl). 2006 Dec;84(12):1055-66. doi: 10.1007/s00109-006-0100-2. Epub 2006 Oct 21.
14 Overexpression of MUC13, a Poor Prognostic Predictor, Promotes Cell Growth by Activating Wnt Signaling in Hepatocellular Carcinoma.Am J Pathol. 2018 Feb;188(2):378-391. doi: 10.1016/j.ajpath.2017.10.016. Epub 2017 Nov 22.
15 MUC1 and MUC13 differentially regulate epithelial inflammation in response to inflammatory and infectious stimuli.Mucosal Immunol. 2013 May;6(3):557-68. doi: 10.1038/mi.2012.98. Epub 2012 Nov 14.
16 Breakdown of mucin as barrier to digestive enzymes in the ischemic rat small intestine.PLoS One. 2012;7(6):e40087. doi: 10.1371/journal.pone.0040087. Epub 2012 Jun 29.
17 Clinical significance of MUC13 in pancreatic ductal adenocarcinoma.HPB (Oxford). 2018 Jun;20(6):563-572. doi: 10.1016/j.hpb.2017.12.003. Epub 2018 Jan 17.
18 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
19 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
20 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
21 Transcriptomic analysis of untreated and drug-treated differentiated HepaRG cells over a 2-week period. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):27-35.
22 Identification of a transcriptomic signature of food-relevant genotoxins in human HepaRG hepatocarcinoma cells. Food Chem Toxicol. 2020 Jun;140:111297. doi: 10.1016/j.fct.2020.111297. Epub 2020 Mar 28.
23 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.