Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTYHXLWZ)

• DOT Name: Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1)
• Synonyms: BCAT(c); EC 2.6.1.42; Protein ECA39
• Gene Name: BCAT1
• UniProt ID: BCAT1_HUMAN
• PDB ID: 2ABJ; 2COG; 2COI; 2COJ; 7NTR; 7NWA; 7NWB; 7NWC; 7NWE; 7NWM; 7NXN; 7NXO; 7NY2; 7NY9; 7NYA
• EC Number: 2.6.1.42
• Pfam ID: PF01063
• Sequence:
  MKDCSNGCSAECTGEGGSKEVVGTFKAKDLIVTPATILKEKPDPNNLVFGTVFTDHMLTV
  EWSSEFGWEKPHIKPLQNLSLHPGSSALHYAVELFEGLKAFRGVDNKIRLFQPNLNMDRM
  YRSAVRATLPVFDKEELLECIQQLVKLDQEWVPYSTSASLYIRPTFIGTEPSLGVKKPTK
  ALLFVLLSPVGPYFSSGTFNPVSLWANPKYVRAWKGGTGDCKMGGNYGSSLFAQCEAVDN
  GCQQVLWLYGEDHQITEVGTMNLFLYWINEDGEEELATPPLDGIILPGVTRRCILDLAHQ
  WGEFKVSERYLTMDDLTTALEGNRVREMFGSGTACVVCPVSDILYKGETIHIPTMENGPK
  LASRILSKLTDIQYGREESDWTIVLS
• Function: Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine.
• Tissue Specificity: During embryogenesis, expressed in the brain and kidney. Overexpressed in MYC-induced tumors such as Burkitt's lymphoma.
• KEGG Pathway:
  Cysteine and methionine metabolism (hsa00270)
  Valine, leucine and isoleucine degradation (hsa00280)
  Valine, leucine and isoleucine biosynthesis (hsa00290)
  Pantothe.te and CoA biosynthesis (hsa00770)
  Metabolic pathways (hsa01100)
  2-Oxocarboxylic acid metabolism (hsa01210)
  Biosynthesis of amino acids (hsa01230)
  Biosynthesis of cofactors (hsa01240)
• Reactome Pathway: Branched-chain amino acid catabolism (R-HSA-70895)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1) increases the Metabolic disorder ADR of Chlorothiazide.	[23]

24 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[7]
Estradiol	DMUNTE3	Approved	Estradiol increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[9]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[10]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[11]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[12]
Demecolcine	DMCZQGK	Approved	Demecolcine increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[13]
Azacitidine	DMTA5OE	Approved	Azacitidine decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[14]
Fenofibrate	DMFKXDY	Approved	Fenofibrate decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[7]
Ifosfamide	DMCT3I8	Approved	Ifosfamide decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[7]
Clodronate	DM9Y6X7	Approved	Clodronate increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[7]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[15]
Tamibarotene	DM3G74J	Phase 3	Tamibarotene affects the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[3]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[17]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[19]
THAPSIGARGIN	DMDMQIE	Preclinical	THAPSIGARGIN increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[20]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[13]
Deguelin	DMXT7WG	Investigative	Deguelin increases the expression of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[22]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[16]
TAK-243	DM4GKV2	Phase 1	TAK-243 increases the sumoylation of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Branched-chain-amino-acid aminotransferase, cytosolic (BCAT1).	[21]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
• [4] Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Transcriptomics hit the target: monitoring of ligand-activated and stress response pathways for chemical testing. Toxicol In Vitro. 2015 Dec 25;30(1 Pt A):7-18.
• [8] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [11] MS4A3-HSP27 target pathway reveals potential for haematopoietic disorder treatment in alimentary toxic aleukia. Cell Biol Toxicol. 2023 Feb;39(1):201-216. doi: 10.1007/s10565-021-09639-4. Epub 2021 Sep 28.
• [12] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [13] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [14] The effect of DNA methylation inhibitor 5-Aza-2'-deoxycytidine on human endometrial stromal cells. Hum Reprod. 2010 Nov;25(11):2859-69.
• [15] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [16] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [17] Targeting MYCN in neuroblastoma by BET bromodomain inhibition. Cancer Discov. 2013 Mar;3(3):308-23.
• [18] Inhibiting ubiquitination causes an accumulation of SUMOylated newly synthesized nuclear proteins at PML bodies. J Biol Chem. 2019 Oct 18;294(42):15218-15234. doi: 10.1074/jbc.RA119.009147. Epub 2019 Jul 8.
• [19] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [20] Endoplasmic reticulum stress impairs insulin signaling through mitochondrial damage in SH-SY5Y cells. Neurosignals. 2012;20(4):265-80.
• [21] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [22] Neurotoxicity and underlying cellular changes of 21 mitochondrial respiratory chain inhibitors. Arch Toxicol. 2021 Feb;95(2):591-615. doi: 10.1007/s00204-020-02970-5. Epub 2021 Jan 29.
• [23] Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.