Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE87OZS)

DME Name	Arachidonate 5-lipoxygenase (ALOX5)
Synonyms	Enzyme 5-lipoxygenase; 5-lipoxygenase; ALOX5; LOG5; Alox5; 5-LOX; 5LO; 5LX; AI850497; F730011J02; 5LPG; 5-LO
Gene Name	ALOX5
UniProt ID	LOX5_HUMAN
INTEDE ID	DME0201
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Gene ID	240
EC Number	EC: 1.13.11.34 Oxidoreductase Oxygen single donor oxidoreductase Oxygen single donor oxidoreductase EC: 1.13.11.34
Lineage	Species: Homo sapiens Kingdom: Metazoa Phylum: Chordata Class: Mammalia Order: Primates Family: Hominidae Genus: Homo Species: Homo sapiens
Sequence	MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY YYLSPDRIPNSVAI
Function	This enzyme catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
KEGG Pathway	Arachidonic acid metabolism (hsa00590 ) Fc epsilon RI signaling pathway (hsa04664 ) Metabolic pathways (hsa01100 ) Ovarian steroidogenesis (hsa04913 ) Serotonergic synapse (hsa04726 ) Toxoplasmosis (hsa05145 )
Reactome Pathway	Biosynthesis of DPAn-3-derived 13-series resolvins (R-HSA-9026403 ) Biosynthesis of DPAn-3-derived maresins (R-HSA-9026290 ) Biosynthesis of DPAn-3-derived protectins and resolvins (R-HSA-9026286 ) Biosynthesis of E-series 18(R)-resolvins (R-HSA-9023661 ) Biosynthesis of E-series 18(S)-resolvins (R-HSA-9018896 ) Biosynthesis of aspirin-triggered D-series resolvins (R-HSA-9020265 ) Biosynthesis of electrophilic Omega-3 PUFA oxo-derivatives (R-HSA-9027604 ) Biosynthesis of maresins (R-HSA-9018682 ) Interleukin-18 signaling (R-HSA-9012546 ) Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807 ) Neutrophil degranulation (R-HSA-6798695 ) Synthesis of 5-eicosatetraenoic acids (R-HSA-2142688 ) Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691 ) Synthesis of Lipoxins (LX) (R-HSA-2142700 ) Biosynthesis of D-series resolvins (R-HSA-9018676 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DME

1 Approved Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Epanova	DMHEAGL	Hypertriglyceridemia	5C80.1	Approved	[116]
------------------------------------------------------------------------------------

1 Clinical Trial Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Omega-6-FA	DMBWY8V	Attention deficit hyperactivity disorder	6A05.Z	Phase 3	[117]
------------------------------------------------------------------------------------

1 Investigative Drug(s) Metabolized by This DME

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Arachidonic acid	DMUOQZD	Discovery agent	N.A.	Investigative	[118]
------------------------------------------------------------------------------------

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA)

MEA Detail

Jump to Detail Molecular Expression Atlas of This DME

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Acute myelocytic leukaemia	2B33.1	Bone marrow	7.95E-43	-1.65E+00	-1.80E+00
Alopecia	ED70	Skin from scalp	7.26E-05	2.53E-01	1.00E+00
Alzheimer's disease	8A20	Entorhinal cortex	5.43E-08	4.11E-01	8.14E-01
Ankylosing spondylitis	FA92.0	Pheripheral blood	6.26E-01	-2.39E-02	-4.28E-02
Aortic stenosis	BB70	Calcified aortic valve	8.28E-03	2.57E-01	7.96E-01
Apnea	7A40	Hyperplastic tonsil	9.02E-01	-3.33E-02	-1.68E-01
Arthropathy	FA00-FA5Z	Peripheral blood	6.70E-02	4.60E-01	1.17E+00
Asthma	CA23	Nasal and bronchial airway	9.43E-03	1.39E-01	2.81E-01
Atopic dermatitis	EA80	Skin	2.96E-03	-2.18E-01	-7.78E-01
Autism	6A02	Whole blood	3.86E-01	1.51E-01	1.98E-01
Autoimmune uveitis	9A96	Peripheral monocyte	4.91E-01	-6.12E-01	-9.77E-01
Autosomal dominant monocytopenia	4B04	Whole blood	3.78E-01	-4.94E-01	-6.40E-01
Bacterial infection of gingival	1C1H	Gingival tissue	1.45E-19	7.07E-01	1.93E+00
Batten disease	5C56.1	Whole blood	8.24E-01	-1.21E-01	-2.96E-01
Behcet's disease	4A62	Peripheral blood	8.84E-01	-8.44E-02	-2.14E-01
Bipolar disorder	6A60-6A6Z	Prefrontal cortex	2.41E-02	-9.26E-02	-5.68E-01
Bladder cancer	2C94	Bladder tissue	1.26E-04	-2.03E+00	-3.53E+00
Breast cancer	2C60-2C6Z	Breast tissue	3.82E-06	1.20E-01	2.65E-01
Cardioembolic stroke	8B11.20	Whole blood	4.50E-03	2.82E-01	7.00E-01
Cervical cancer	2C77	Cervical tissue	7.96E-02	8.87E-02	2.76E-01
Childhood onset rheumatic disease	FA20.Z	Peripheral blood	6.54E-01	1.23E-01	9.17E-02
Chronic hepatitis C	1E51.1	Whole blood	9.93E-01	-1.79E-01	-2.67E-01
Chronic obstructive pulmonary disease	CA22	Lung tissue	7.42E-01	-1.76E-01	-2.47E-01
Chronic obstructive pulmonary disease	CA22	Small airway epithelium	1.25E-03	4.34E-01	6.27E-01
Chronic rhinosinusitis	CA0A	Sinus mucosa tissue	6.44E-03	1.65E-01	2.33E+00
Colon cancer	2B90	Colon tissue	4.80E-04	-2.22E-01	-7.13E-01
Coronary artery disease	BA80-BA8Z	Peripheral blood	3.33E-01	-3.46E-02	-7.57E-01
Diffuse large B-cell lymphoma	2A81	Tonsil tissue	9.25E-01	6.32E-01	6.20E-01
Endometriosis	GA10	Endometrium tissue	2.47E-02	4.32E-01	9.21E-01
Familial hypercholesterolemia	5C80.00	Peripheral blood	4.99E-01	-1.06E-01	-2.43E-01
Familial hypercholesterolemia	5C80.00	Whole blood	6.44E-03	1.60E-01	4.33E-01
Gastric cancer	2B72	Gastric tissue	1.90E-01	2.12E-01	7.81E-01
Glioblastopma	2A00.00	Nervous tissue	2.58E-15	2.27E-01	4.11E-01
Glioma	2A00.0Y-2A00.0Z	Brain stem tissue	8.08E-01	-5.05E-02	-1.64E-01
Glioma	2A00.0Y-2A00.0Z	White matter tissue	2.57E-01	-2.44E-01	-3.60E-01
Head and neck cancer	2D42	Head and neck tissue	2.59E-04	2.64E-01	5.51E-01
HIV-associated neurocognitive impairment	8A2Y-8A2Z	White matter tissue	3.53E-01	3.50E-02	1.53E-01
Huntington's disease	8A01.10	Whole blood	2.32E-01	4.90E-02	7.85E-02
Idiopathic pulmonary fibrosis	CB03.4	Lung tissue	2.82E-01	3.47E-01	7.97E-01
Immunodeficiency	4A00-4A20	Peripheral blood	1.72E-01	-1.38E-01	-5.76E-01
Influenza	1E30	Whole blood	1.28E-01	8.66E-01	2.13E+00
Interstitial cystitis	GC00.3	Bladder tissue	2.42E-04	-1.77E+00	-3.90E+00
Intracranial aneurysm	8B01.0	Intracranial artery	2.08E-04	1.15E+00	4.55E+00
Irritable bowel syndrome	DD91.0	Rectal colon tissue	5.51E-01	1.19E-02	4.25E-02
Ischemic stroke	8B11	Peripheral blood	3.90E-01	-8.64E-02	-1.87E-01
Juvenile idiopathic arthritis	FA24	Peripheral blood	7.42E-01	-1.37E-01	-1.90E-01
Lateral sclerosis	8B60.4	Skin	7.15E-01	5.00E-02	1.99E-01
Lateral sclerosis	8B60.4	Cervical spinal cord	2.94E-02	1.47E-01	1.04E+00
Liver cancer	2C12.0	Liver tissue	1.16E-04	-3.31E-01	-8.31E-01
Liver failure	DB99.7-DB99.8	Liver tissue	5.69E-04	3.24E-01	2.33E+00
Lung cancer	2C25	Lung tissue	6.11E-92	-1.84E+00	-2.66E+00
Lupus erythematosus	4A40	Whole blood	1.98E-09	5.97E-01	7.20E-01
Major depressive disorder	6A70-6A7Z	Hippocampus	8.98E-01	-3.80E-02	-1.95E-01
Major depressive disorder	6A70-6A7Z	Whole blood	1.42E-01	1.22E-01	2.89E-01
Melanoma	2C30	Skin	5.11E-01	8.43E-02	1.20E-01
Multiple myeloma	2A83.1	Peripheral blood	8.93E-01	-1.22E-02	-8.03E-02
Multiple myeloma	2A83.1	Bone marrow	2.08E-05	7.64E-01	3.50E+00
Multiple sclerosis	8A40	Plasmacytoid dendritic cells	3.99E-01	1.30E-01	5.13E-01
Myelodysplastic syndrome	2A36-2A3Z	Bone marrow	2.37E-01	-3.39E-02	-1.06E-01
Myelofibrosis	2A20.2	Whole blood	1.36E-05	-9.02E-01	-2.55E+00
Myocardial infarction	BA41-BA50	Peripheral blood	3.16E-04	6.19E-01	1.01E+00
Myopathy	8C70.6	Muscle tissue	3.08E-03	6.09E-01	1.70E+00
Neonatal sepsis	KA60	Whole blood	3.46E-35	1.80E+00	2.37E+00
Neuroectodermal tumour	2A00.11	Brain stem tissue	1.75E-04	-9.12E-01	-2.21E+00
Non-alcoholic fatty liver disease	DB92	Liver tissue	1.74E-01	3.89E-01	1.55E+00
Obesity related type 2 diabetes	5A11	Omental adipose tissue	9.93E-01	7.03E-02	4.12E-01
Olive pollen allergy	CA08.00	Peripheral blood	6.98E-02	1.63E-01	1.17E+00
Oral cancer	2B6E	Oral tissue	9.36E-02	-1.05E-01	-3.35E-01
Osteoarthritis	FA00-FA0Z	Synovial tissue	3.25E-01	-2.61E-01	-4.66E-01
Osteoporosis	FB83.1	Bone marrow	5.34E-02	2.91E-01	2.07E+00
Ovarian cancer	2C73	Ovarian tissue	3.87E-04	1.14E+00	2.04E+00
Pancreatic cancer	2C10	Pancreas	1.34E-04	9.01E-01	1.52E+00
Parkinson's disease	8A00.0	Substantia nigra tissue	4.65E-01	3.64E-01	1.07E+00
Pediatric respiratory syncytial virus infection	CA40.11	Peripheral blood	4.79E-04	3.87E-01	8.58E-01
Pituitary cancer	2D12	Pituitary tissue	3.13E-01	3.32E-01	7.47E-01
Pituitary gonadotrope tumour	2D12	Pituitary tissue	3.32E-01	2.12E-01	4.79E-01
Polycystic ovary syndrome	5A80.1	Vastus lateralis muscle	1.63E-01	1.73E-01	7.03E-01
Polycythemia vera	2A20.4	Whole blood	1.11E-02	-2.49E-01	-6.71E-01
Pompe disease	5C51.3	Biceps muscle	6.79E-01	3.41E-03	2.28E-02
Preterm birth	KA21.4Z	Myometrium	8.12E-01	-3.01E-01	-5.05E-01
Prostate cancer	2C82	Prostate	4.15E-01	-6.25E-02	-1.48E-01
Psoriasis	EA90	Skin	5.19E-01	-4.92E-03	-1.45E-02
Rectal cancer	2B92	Rectal colon tissue	5.52E-01	-1.57E-01	-7.67E-01
Renal cancer	2C90-2C91	Kidney	1.02E-04	1.48E+00	2.24E+00
Retinoblastoma	2D02.2	Uvea	1.45E-04	9.11E-01	4.70E+00
Rheumatoid arthritis	FA20	Synovial tissue	1.00E-02	5.46E-01	2.11E+00
Rhinovirus infection	CA42.1	Nasal epithelium tissue	2.94E-01	-2.27E-02	-1.19E-01
Schizophrenia	6A20	Prefrontal cortex	5.52E-02	1.87E-01	1.18E-01
Schizophrenia	6A20	Superior temporal cortex	7.34E-03	3.50E-01	1.17E+00
Scleroderma	4A42.Z	Whole blood	7.86E-02	-2.56E-01	-9.70E-01
Seizure	8A60-8A6Z	Whole blood	6.89E-01	-5.01E-02	-7.89E-02
Sensitive skin	EK0Z	Skin	8.61E-01	7.61E-02	3.78E-01
Sepsis with septic shock	1G41	Whole blood	6.22E-64	1.69E+00	2.27E+00
Shwachman-Diamond syndrome	3A70.0	Bone marrow	4.47E-02	-3.40E-01	-1.04E+00
Sickle cell disease	3A51.0-3A51.3	Peripheral blood	8.02E-01	1.22E-01	5.14E-01
Simpson golabi behmel syndrome	LD2C	Adipose tissue	4.57E-01	9.13E-02	7.89E-01
Sjogren's syndrome	4A43.2	Salivary gland tissue	1.29E-01	4.07E-02	2.11E-01
Skin cancer	2C30-2C3Z	Skin	4.58E-05	-3.14E-01	-8.71E-01
Thrombocythemia	3B63	Whole blood	1.14E-05	-6.94E-01	-1.94E+00
Thrombocytopenia	3B64	Whole blood	1.60E-01	4.81E-01	6.34E-01
Thyroid cancer	2D10	Thyroid	6.80E-29	1.51E+00	2.10E+00
Tibial muscular dystrophy	8C75	Muscle tissue	1.33E-05	5.01E-01	1.76E+00
Tuberous sclerosis complex	LD2D.2	Perituberal tissue	5.17E-01	1.10E-01	6.58E-01
Type 2 diabetes	5A11	Liver tissue	6.81E-01	1.13E-01	4.94E-01
Ureter cancer	2C92	Urothelium	9.19E-01	-1.32E-03	-5.71E-03
Uterine cancer	2C78	Endometrium tissue	8.34E-02	-3.69E-02	-7.20E-02
Vitiligo	ED63.0	Skin	4.69E-01	-1.12E-02	-3.24E-02
------------------------------------------------------------------------------------


⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name

Arachidonate 5-lipoxygenase (5-LOX) DTT Info

DME DTT Type

Successful

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Diethylcarbamazine	DM1TJ8F	Lymphatic filariasis	1F66.3	Approved	[1]
Zileuton	DMVRIC2	Asthma	CA23	Approved	[2], [3], [4], [5], [6], [7]
3,4-Dihydroxycinnamic Acid	DMVZL26	Thrombocytopenia	3B64	Phase 4	[8], [9], [10]
Silymarin	DMXBYQR	N. A.	N. A.	Phase 4	[11]
------------------------------------------------------------------------------------

22 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-761	DM3FIC2	Asthma	CA23	Phase 3	[12], [13], [14]
Avastin+/-Tarceva	DMA86FL	Non-small-cell lung cancer	2C25.Y	Phase 3	[15]
Flobufen	DMPSG4D	Rheumatoid arthritis	FA20	Phase 3	[16]
FPL-62064	DMGF8MZ	Inflammation	1A00-CA43.1	Phase 3	[17]
Tenidap	DMHQRYE	Rheumatoid arthritis	FA20	Phase 3	[18]
Darbufelone	DMYVKM5	Asthma	CA23	Phase 2/3	[19]
BAICALEIN	DM4C7E6	Influenza virus infection	1E30-1E32	Phase 2	[20]
BIM23A760	DM6EIZG	Acromegaly	5A60.0	Phase 2	[7], [21]
CMI-392	DM1NCUY	Psoriasis vulgaris	EA90	Phase 2	[22]
E-6700	DMUWJI4	Asthma	CA23	Phase 2	[23]
MK-866	DMQHS6B	Discovery agent	N.A.	Phase 2	[24]
PF-4191834	DM3DWKN	Asthma	CA23	Phase 2	[25]
PTC299	DMP9TKE	Rheumatoid arthritis	FA20	Phase 2	[26]
Q301	DME71WA	Atopic dermatitis	EA80	Phase 2	[27]
Rilopirox	DM3L51O	Fungal infection	1F29-1F2F	Phase 2	[28]
TA-270	DMZ7I51	Asthma	CA23	Phase 2	[29]
Tepoxalin	DMVS61L	Asthma	CA23	Phase 2	[30]
Tipelukast	DMS9BDQ	Asthma	CA23	Phase 2	[31]
UCB-35440	DM5Z34K	Rhinitis	FA20	Phase 2	[32]
WY-50295-tromethamine	DMFVNSB	Asthma	CA23	Phase 2	[33]
BF-389	DMHELFU	Rheumatoid arthritis	FA20	Phase 1	[34]
SKF-105809	DMUN7EQ	Pain	MG30-MG3Z	Phase 1	[35]
------------------------------------------------------------------------------------


⏷ Show the Full List of 22 Clinical Trial Drug(s)

48 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ibuproxam	DMSO2T9	Respiratory disease	CB40	Withdrawn from market	[36]
CJ-13610	DM1CDNS	Asthma	CA23	Discontinued in Phase 2	[37]
CV-6504	DMG3HX2	N. A.	N. A.	Discontinued in Phase 2	[38], [39]
DuP-654	DMQ9IO0	Pruritus	EC90	Discontinued in Phase 2	[40]
E-3040	DM35KZG	Thrombosis	DB61-GB90	Discontinued in Phase 2	[41]
E-6080	DM296V7	Asthma	CA23	Discontinued in Phase 2	[42]
ETH615	DMEGMA2	Dermatitis	EA80-EA89	Discontinued in Phase 2	[7]
FPL-64170	DML6MVP	Psoriasis vulgaris	EA90	Discontinued in Phase 2	[43]
Linetastine	DMF8B62	Rhinitis	FA20	Discontinued in Phase 2	[7], [44]
MK-591	DMVXTZG	Asthma	CA23	Discontinued in Phase 2	[45], [46]
MK-886	DMT0O7H	Asthma	CA23	Discontinued in Phase 2	[47]
MLN-977	DMTWLG8	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 2	[48]
OPC-21268	DM7OVMH	Cardiac disease	BA00-BE2Z	Discontinued in Phase 2	[49]
R-68151	DM2NTJY	Psoriasis vulgaris	EA90	Discontinued in Phase 2	[7], [50]
SC-45662	DMQ0T6L	Asthma	CA23	Discontinued in Phase 2	[51]
TEBUFELONE	DMMUE8P	Pain	MG30-MG3Z	Discontinued in Phase 2	[52]
AZD-4407	DM7XQTM	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 1	[53]
CD-581	DMOCBQW	Atopic dermatitis	EA80	Discontinued in Phase 1	[54]
Licofelone	DM7HLFD	Osteoarthritis	FA00-FA05	Discontinued in Phase 1	[55], [56], [57], [58]
A-78773	DM4HRXI	Asthma	CA23	Terminated	[59]
A-79175	DMT5ZFG	Asthma	CA23	Terminated	[60], [61]
A-80263	DM89BGE	Inflammation	1A00-CA43.1	Terminated	[62]
AA-861	DMPEB0Z	Allergy	4A80-4A85	Terminated	[63], [64], [65], [66]
BI-L-357	DMBR48G	Asthma	CA23	Terminated	[67]
BU-4601A	DM4OT0S	Asthma	CA23	Terminated	[68]
BW A4C	DMNUMDG	Arthritis	FA20	Terminated	[69], [70], [71]
BW B70C	DMTYCJ6	Asthma	CA23	Terminated	[71]
BW755C	DMQM3P4	Inflammation	1A00-CA43.1	Terminated	[72]
CGS 8515	DMKUETX	N. A.	N. A.	Terminated	[73]
CGS-26529	DMJ4FGZ	Inflammation	1A00-CA43.1	Terminated	[74]
CI-986	DMI0TD8	Rheumatoid arthritis	FA20	Terminated	[75]
CMI-206	DMEIW7K	Inflammation	1A00-CA43.1	Terminated	[76]
Epocarbazolin-A	DMWRSXK	Asthma	CA23	Terminated	[77]
ER-34122	DMAZVUB	Inflammation	1A00-CA43.1	Terminated	[78], [79]
KC-11404	DM3H90W	Asthma	CA23	Terminated	[80]
KC-11425	DMC295V	Asthma	CA23	Terminated	[81]
LY-221068	DMJ54E9	Arthritis	FA20	Terminated	[82]
NAFAZATROM	DM31CV2	N. A.	N. A.	Terminated	[83]
PD-146176	DMHQSF8	Arteriosclerosis	BD40	Terminated	[84]
R zileuton	DMA187T	Asthma	CA23	Terminated	[85]
R-85355	DMZQJVN	N. A.	N. A.	Terminated	[50]
REV-5901	DMI94L1	N. A.	N. A.	Terminated	[20]
RWJ-63556	DMUDE1T	Arthritis	FA20	Terminated	[86]
Sch-40120	DMXBJCY	Pruritus	EC90	Terminated	[87]
SKF-104351	DM8MWFZ	Rheumatoid arthritis	FA20	Terminated	[88]
WY-28342	DMAG86C	Rheumatoid arthritis	FA20	Terminated	[89]
ZD-7717	DMJEZOP	Asthma	CA23	Terminated	[90]
ZM-230487	DM0TBQK	Asthma	CA23	Terminated	[91]
------------------------------------------------------------------------------------


⏷ Show the Full List of 48 Discontinued Drug(s)

115 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,2-Dihydro-indazol-3-one	DM9G7DT	Discovery agent	N.A.	Investigative	[20]
1,2-Dihydroxy-10H-anthracen-9-one	DMASC8K	Discovery agent	N.A.	Investigative	[15]
1,3,8-Trihydroxy-6-methyl-10H-anthracen-9-one	DMRP03X	Discovery agent	N.A.	Investigative	[15]
1,5-Dihydroxy-10H-anthracen-9-one	DMC7FLT	Discovery agent	N.A.	Investigative	[15]
1,8,9-Trimethoxy-9,10-dihydro-anthracene	DMVHE1P	Discovery agent	N.A.	Investigative	[15]
1,8-Dichloro-10H-anthracen-9-one	DMZK4DL	Discovery agent	N.A.	Investigative	[15]
1,8-Dihydroxy-2-propionyl-10H-anthracen-9-one	DMDFBSX	Discovery agent	N.A.	Investigative	[15]
1-Benzyl-1,2-dihydro-indazol-3-one	DM17TIX	Discovery agent	N.A.	Investigative	[20]
1-furan-2-yl-3-pyridin-2-yl-propenone (FPP-3)	DM7UK56	Discovery agent	N.A.	Investigative	[92]
1-Hydroxy-10H-anthracen-9-one	DM235CQ	Discovery agent	N.A.	Investigative	[15]
1-Hydroxy-8-methoxy-10H-anthracen-9-one	DMRNO5U	Discovery agent	N.A.	Investigative	[15]
1-Methyl-1,2-dihydro-indazol-3-one	DM1BGQN	Discovery agent	N.A.	Investigative	[20]
10-Acetyl-1,8-dihydroxy-10H-anthracen-9-one	DM5BUXZ	Discovery agent	N.A.	Investigative	[15]
10-Benzoyl-1,8-dihydroxy-10H-anthracen-9-one	DM4M2VU	Discovery agent	N.A.	Investigative	[15]
15-hydroxyeicosatetraenoic acid	DMEML8B	Discovery agent	N.A.	Investigative	[7], [93]
2'-Nitro-biphenyl-4-carboxylic acid hydroxyamide	DM2NX4K	Discovery agent	N.A.	Investigative	[94]
2-(1H-Indol-3-ylmethyl)-1,2-dihydro-indazol-3-one	DMB7AU5	Discovery agent	N.A.	Investigative	[20]
2-(3-Phenyl-propyl)-1,2-dihydro-indazol-3-one	DMIQBXD	Discovery agent	N.A.	Investigative	[20]
2-(4-Butoxy-phenoxy)-N-hydroxy-acetamide	DMG32HQ	Discovery agent	N.A.	Investigative	[94]
2-(4-Butoxy-phenoxy)-N-hydroxy-N-methyl-acetamide	DMEKNZW	Discovery agent	N.A.	Investigative	[94]
2-(4-Butoxy-phenoxy)-N-hydroxy-propionamide	DMO5IM0	Discovery agent	N.A.	Investigative	[94]
2-(4-Butoxy-phenyl)-N-hydroxy-N-methyl-acetamide	DMP7CF8	Discovery agent	N.A.	Investigative	[94]
2-(4-hydroxylphenyl)-3-(3,5-dihydroxylphenyl) propenoic acid (NNU-hdpa)	DMM4S1R	Discovery agent	N.A.	Investigative	[95]
2-(4-Methoxy-phenyl)-5-phenyl-thiazol-4-ol	DMZ9A6U	Discovery agent	N.A.	Investigative	[96]
2-(4-Phenyl-butyl)-1,2-dihydro-indazol-3-one	DMEQ063	Discovery agent	N.A.	Investigative	[20]
2-Benzyl-1,2-dihydro-indazol-3-one	DM1CB5J	Discovery agent	N.A.	Investigative	[20]
2-Biphenyl-4-yl-N-hydroxy-N-methyl-acetamide	DMWOJ5N	Discovery agent	N.A.	Investigative	[94]
2-Furan-2-ylmethyl-1,2-dihydro-indazol-3-one	DMQIRY7	Discovery agent	N.A.	Investigative	[20]
2-Methyl-1,2-dihydro-indazol-3-one	DMDJHFQ	Discovery agent	N.A.	Investigative	[20]
2-Naphthalen-1-ylmethyl-1,2-dihydro-indazol-3-one	DMIDGNB	Discovery agent	N.A.	Investigative	[20]
2-Naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one	DM1EJ6W	Discovery agent	N.A.	Investigative	[20]
2-Phenethyl-1,2-dihydro-indazol-3-one	DM0WMBC	Discovery agent	N.A.	Investigative	[20]
2-Phenyl-1,2-dihydro-indazol-3-one	DM28CLZ	Discovery agent	N.A.	Investigative	[20]
2-Pyridin-2-ylmethyl-1,2-dihydro-indazol-3-one	DMAS46B	Discovery agent	N.A.	Investigative	[20]
2-Pyridin-3-ylmethyl-1,2-dihydro-indazol-3-one	DMJYI0P	Discovery agent	N.A.	Investigative	[70], [20]
2-Pyridin-4-ylmethyl-1,2-dihydro-indazol-3-one	DMGB1QU	Discovery agent	N.A.	Investigative	[20]
2-Thiazol-5-ylmethyl-1,2-dihydro-indazol-3-one	DM35JQS	Discovery agent	N.A.	Investigative	[20]
2-Thiophen-2-ylmethyl-1,2-dihydro-indazol-3-one	DM4J8B9	Discovery agent	N.A.	Investigative	[20]
3,4-Dihydroxy-10H-anthracen-9-one	DMG4NR3	Discovery agent	N.A.	Investigative	[15]
3-(4-Butoxy-phenyl)-N-hydroxy-N-methyl-acrylamide	DM8W3GC	Discovery agent	N.A.	Investigative	[94]
3-Benzoyl-N-hydroxy-benzamide	DM25K86	Discovery agent	N.A.	Investigative	[94]
3-Biphenyl-3-yl-N-hydroxy-N-methyl-acrylamide	DMHSAOQ	Discovery agent	N.A.	Investigative	[94]
3-Biphenyl-4-yl-N-hydroxy-N-methyl-acrylamide	DMKBRIM	Discovery agent	N.A.	Investigative	[94]
4,5-Dihydroxy-10H-anthracen-9-one	DMG8KRN	Discovery agent	N.A.	Investigative	[15]
4,5-Dimethoxy-10H-anthracen-9-one	DM34L89	Discovery agent	N.A.	Investigative	[15]
4-(1H-indol-3-yl)-1-morpholinobutan-1-one	DM9FKSM	Discovery agent	N.A.	Investigative	[97]
4-Bromo-N-hydroxy-benzamide	DMF38M5	Discovery agent	N.A.	Investigative	[94]
4-Butoxy-N-hydroxy-N-methyl-benzamide	DMFCB7L	Discovery agent	N.A.	Investigative	[94]
4-Hydroxy-5-methoxy-10H-anthracen-9-one	DMVFKSX	Discovery agent	N.A.	Investigative	[15]
4-Pentadeca-1,3,6-trienylsulfanyl-butyric acid	DMN1XMK	Discovery agent	N.A.	Investigative	[83]
5,8-Dihydroxy-1,4-naphthoquinone	DMOCEPA	Malaria	1F40-1F45	Investigative	[15]
5-Chloro-N-(4-ethylphenyl)benzo[d]oxazol-2-amine	DM2SKP7	Discovery agent	N.A.	Investigative	[98]
5-Chloro-N-phenylbenzo[d]oxazol-2-amine	DMVQLFB	Discovery agent	N.A.	Investigative	[98]
5-Methoxy-N-phenylbenzo[d]oxazol-2-amine	DM98EQX	Discovery agent	N.A.	Investigative	[98]
5-Methyl-2-p-tolyl-thiazol-4-ol	DMIE9BG	Discovery agent	N.A.	Investigative	[96]
5-Methyl-N-phenylbenzo[d]oxazol-2-amine	DMNJ0XZ	Discovery agent	N.A.	Investigative	[98]
5S-HETE	DM3Z6G4	Discovery agent	N.A.	Investigative	[7], [93]
7-tert-butyl-2, 3-dihydro-3, 3-dimethyl substituted dihydrofuran 30 (DHDMBF30)	DMSU06X	Discovery agent	N.A.	Investigative	[99]
Acacetin	DMQOB0X	Discovery agent	N.A.	Investigative	[100]
Acanthus ilicifolius Linn	DMZDFRI	Discovery agent	N.A.	Investigative	[72]
Acetic acid 2-phenyl-5-propyl-thiazol-4-yl ester	DMUYKIE	Discovery agent	N.A.	Investigative	[96]
Acetic acid 5-butyl-2-phenyl-thiazol-4-yl ester	DM95QEA	Discovery agent	N.A.	Investigative	[96]
Anthracene-2-carboxylic acid hydroxyamide	DMRC3OU	Discovery agent	N.A.	Investigative	[94]
ANTHRONE	DMWZ093	Discovery agent	N.A.	Investigative	[15]
Biphenyl-3-carboxylic acid hydroxyamide	DMROG71	Discovery agent	N.A.	Investigative	[94]
Biphenyl-4-carboxylic acid hydroxyamide	DMK5VYG	Discovery agent	N.A.	Investigative	[94]
BUDDLEDIN A	DMGFY4X	Discovery agent	N.A.	Investigative	[100]
BW A360C	DMNSLGC	Discovery agent	N.A.	Investigative	[71]
BW B218C	DMHQP84	Discovery agent	N.A.	Investigative	[71]
BW-858C	DMM2WPH	Asthma	CA23	Investigative	[101]
BW-A137C	DM7SNU0	Discovery agent	N.A.	Investigative	[102]
CGS-23885	DM5P7TR	Discovery agent	N.A.	Investigative	[103]
Chebulagic acid	DM0H7AV	Discovery agent	N.A.	Investigative	[104]
CYLINDOL A	DMTS8D5	Discovery agent	N.A.	Investigative	[105]
FR-122788	DMNMO83	Discovery agent	N.A.	Investigative	[106]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[107]
Hexanoic acid 2,5-diphenyl-thiazol-4-yl ester	DM4U0L1	Discovery agent	N.A.	Investigative	[96]
Hyperforin	DM2L3PE	Discovery agent	N.A.	Investigative	[108]
ICI-211965	DMYRILU	Discovery agent	N.A.	Investigative	[109]
L-652,343	DMA23LP	Discovery agent	N.A.	Investigative	[110]
N-(2-Ethylphenyl)-5-methylbenzo[d]oxazol-2-amine	DMMDXEO	Discovery agent	N.A.	Investigative	[98]
N-(3-Bromophenyl)-5-methoxybenzo[d]oxazol-2-amine	DM0Z1HJ	Discovery agent	N.A.	Investigative	[98]
N-(4-Ethylphenyl)-5-methylbenzo[d]oxazol-2-amine	DMIWNAY	Discovery agent	N.A.	Investigative	[98]
N-(4-Ethylphenyl)benzo[d]oxazol-2-amine	DMJ73T6	Discovery agent	N.A.	Investigative	[98]
N-Hydroxy-2-methyl-3-naphthalen-2-yl-acrylamide	DME96RF	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-2-naphthalen-2-yl-acetamide	DMYDX34	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-3-naphthalen-2-yl-acrylamide	DMZ3INJ	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-3-naphthalen-2-yl-N-p-tolyl-acrylamide	DMKBACJ	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-3-naphthalen-2-yl-N-phenyl-acrylamide	DMVOPXE	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-3-naphthalen-2-yl-propionamide	DMPIMRC	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-3-phenyl-acrylamide	DM9IPTV	Discovery agent	N.A.	Investigative	[94]
N-hydroxy-4-(naphthalen-1-yl)benzamide	DMSHQE3	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-4-iodo-benzamide	DMEO7L5	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-4-isobutyl-benzamide	DM16G80	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-4-naphthalen-2-yl-benzamide	DMMHQE8	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-2,3,3-triphenyl-acrylamide	DMQ4ST2	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-2-naphthalen-2-yl-propionamide	DMNVD8I	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-3-naphthalen-1-yl-acrylamide	DMSRPI8	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-3-naphthalen-2-yl-acrylamide	DMANTW0	Discovery agent	N.A.	Investigative	[36]
N-Hydroxy-N-methyl-3-naphthalen-2-yl-propionamide	DMMYV34	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-3-phenanthren-2-yl-acrylamide	DMAN57F	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-3-phenanthren-3-yl-acrylamide	DMV8UCK	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-3-phenanthren-9-yl-acrylamide	DMQBD27	Discovery agent	N.A.	Investigative	[94]
N-Hydroxy-N-methyl-benzamide	DMDQWOB	Discovery agent	N.A.	Investigative	[94]
N-hydroxy-N-[1-(4-isobutylphenyl)ethyl]urea	DM4E8NJ	Discovery agent	N.A.	Investigative	[111]
N-Phenylbenzo[d]oxazol-2-amine	DMXANES	Discovery agent	N.A.	Investigative	[98]
Naphthalene-2-carboxylic acid hydroxyamide	DMG8A74	Discovery agent	N.A.	Investigative	[94]
Phenanthrene-2-carboxylic acid hydroxyamide	DMYT8UG	Discovery agent	N.A.	Investigative	[94]
Phenanthrene-3-carboxylic acid hydroxyamide	DMRYJBA	Discovery agent	N.A.	Investigative	[94]
PHENIDONE	DMJD8XN	Discovery agent	N.A.	Investigative	[105]
Pyrogallol	DMG5KDY	Discovery agent	N.A.	Investigative	[15]
SB-202235	DM09UIS	Discovery agent	N.A.	Investigative	[112]
SC-41661A	DMCWZ84	Discovery agent	N.A.	Investigative	[113]
SK&F 107649	DMU1P3T	Discovery agent	N.A.	Investigative	[114]
TZI-41127	DMSI0HE	Discovery agent	N.A.	Investigative	[115]
------------------------------------------------------------------------------------


⏷ Show the Full List of 115 Investigative Drug(s)

References

1	Inhibition of leukotriene formation by diethylcarbamazine modifies the acid-base balance in the rabbits with blast injuries of the lungs. Vojnosanit Pregl. 1999 May-Jun;56(3):243-7.
2	5-lipoxygenase inhibitor zileuton attenuates ischemic brain damage: involvement of matrix metalloproteinase 9. Neurol Res. 2009 Oct;31(8):848-52.
3	5-lipoxygenase pharmacogenetics in asthma: overlap with Cys-leukotriene receptor antagonist loci. Pharmacogenet Genomics. 2009 Mar;19(3):244-7.
4	Oxygen-glucose deprivation activates 5-lipoxygenase mediated by oxidative stress through the p38 mitogen-activated protein kinase pathway in PC12 cells. J Neurosci Res. 2009 Mar;87(4):991-1001.
5	Overexpression of 5-lipoxygenase in colon polyps and cancer and the effect of 5-LOX inhibitors in vitro and in a murine model. Clin Cancer Res. 2008 Oct 15;14(20):6525-30.
6	Leukotrienes in respiratory disease. Paediatr Respir Rev. 2001 Sep;2(3):238-44.
7	Preview of potential therapeutic applications of leukotriene B4 inhibitors in dermatology. Skin Pharmacol Appl Skin Physiol. 2000 Sep-Oct;13(5):235-45.
8	Phenidone protects the nigral dopaminergic neurons from LPS-induced neurotoxicity. Neurosci Lett. 2008 Nov 7;445(1):1-6.
9	Protection of mouse brain from aluminum-induced damage by caffeic acid. CNS Neurosci Ther. 2008 Spring;14(1):10-6.
10	Involvement of the 5-lipoxygenase pathway in the neurotoxicity of the prion peptide PrP106-126. J Neurosci Res. 2001 Sep 15;65(6):565-72.
11	Anti-inflammatory and anti-arthritic activities of silymarin acting through inhibition of 5-lipoxygenase. Phytomedicine. 2000 Mar;7(1):21-4.
12	Treatment with 5-lipoxygenase inhibitor VIA-2291 (Atreleuton) in patients with recent acute coronary syndrome. Circ Cardiovasc Imaging. 2010 May;3(3):298-307.
13	The novel 5-lipoxygenase inhibitor ABT-761 attenuates cerebral vasospasm in a rabbit model of subarachnoid hemorrhage. Neurosurgery. 2001 Nov;49(5):1205-12; discussion 1212-3.
14	N-hydroxyurea and hydroxamic acid inhibitors of cyclooxygenase and 5-lipoxygenase. Bioorg Med Chem Lett. 1999 Apr 5;9(7):979-84.
15	Simple analogues of anthralin: unusual specificity of structure and antiproliferative activity. J Med Chem. 1997 Nov 7;40(23):3773-80.
16	Pharmacological profile of the novel potent antirheumatic 4-(2',4'-difluorobiphenyl-4-yl)-2-methyl-4-oxobutanoic acid. Arzneimittelforschung. 1997 May;47(5):648-52.
17	FPL 62064, a topically active 5-lipoxygenase/cyclooxygenase inhibitor. Agents Actions. 1990 Jun;30(3-4):432-42.
18	The in vitro free radical scavenging activity of tenidap, a new dual cyclo-oxygenase and 5-1ipoxygenase inhibitor. Mediators Inflamm. 1992;1(2):141-3.
19	Novel dual cyclooxygenase and lipoxygenase inhibitors targeting hyaluronan-CD44v6 pathway and inducing cytotoxicity in colon cancer cells. Bioorg Med Chem. 2013 May 1;21(9):2551-9.
20	Indazolinones, a new series of redox-active 5-lipoxygenase inhibitors with built-in selectivity and oral activity. J Med Chem. 1991 Mar;34(3):1028-36.
21	Pharmacologic and clinical effects of lonapalene (RS 43179), a 5-lipoxygenase inhibitor, in psoriasis. J Invest Dermatol. 1990 Jul;95(1):50-4.
22	Anti-inflammatory activities of LDP-392, a dual PAF receptor antagonist and 5-lipoxygenase inhibitor. Pharmacol Res. 2001 Sep;44(3):213-20.
23	Structure-activity relationships of (E)-3-(1,4-benzoquinonyl)-2-[(3-pyridyl)-alkyl]-2-propenoic acid derivatives that inhibit both 5-lipoxygenase and thromboxane A2 synthetase. J Med Chem. 1996 Aug 2;39(16):3148-57.
24	Inhibition of leukotriene synthesis with MK-886 prevents a rise in blood pressure and reduces noradrenaline-evoked contraction in L-NAME-treated rats
25	Pharmacology of PF-4191834, a novel, selective non-redox 5-lipoxygenase inhibitor effective in inflammation and pain. J Pharmacol Exp Ther. 2010 Jul;334(1):294-301.
26	Therapeutic intervention in a rat model of ARDS: I. Dual inhibition of arachidonic acid metabolism. Circ Shock. 1990 Nov;32(3):231-42.
27	Clinical pipeline report, company report or official report of Qurient.
28	Therapy of seborrheic eczema with an antifungal agent with an antiphlogistic effect. Mycoses. 1991;34 Suppl 1:91-3.
29	TA-270 [4-hydroxy-1-methyl-3-octyloxy-7-sinapinoylamino-2(1H)-quinolinone], an anti-asthmatic agent, inhibits leukotriene production induced by IgE... J Pharmacol Exp Ther. 2003 Nov;307(2):583-8.
30	Preclinical toxicity evaluation of tepoxalin, a dual inhibitor of cyclooxygenase and 5-lipoxygenase, in Sprague-Dawley rats and beagle dogs. Fundam Appl Toxicol. 1996 Sep;33(1):38-48.
31	Company report (MediciNova)
32	The effect of a novel, dual function histamine H1 receptor antagonist/5-lipoxygenase enzyme inhibitor on in vivo dermal inflammation and extravasat... Eur J Pharmacol. 2005 Jan 4;506(3):265-71.
33	WY-50295 tromethamine: a 5-lipoxygenase inhibitor without activity in human whole blood. Prostaglandins Leukot Essent Fatty Acids. 1999 Jan;60(1):31-41.
34	Antiarthritic profile of BF-389--a novel anti-inflammatory agent with low ulcerogenic liability. Agents Actions. 1992 Sep;37(1-2):90-8.
35	Analgetic activity of SK&F 105809, a dual inhibitor of arachidonic acid metabolism. Agents Actions Suppl. 1991;32:113-7.
36	In vivo characterization of hydroxamic acid inhibitors of 5-lipoxygenase. J Med Chem. 1987 Nov;30(11):2121-6.
37	Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91.
38	A phase II study of the 5-lipoxygenase inhibitor, CV6504, in advanced pancreatic cancer: correlation of clinical data with pharmacokinetic and pharmacodynamic endpoints. Ann Oncol. 2000 Sep;11(9):1165-70.
39	Involvement of thromboxane A2, leukotrienes and free radicals in puromycin nephrosis in rats. Kidney Int. 1991 May;39(5):920-9.
40	The lipoxygenase inhibitor 2-phenylmethyl-1-naphthol (DuP 654) is a 12(S)-hydroxyeicosatetraenoic acid receptor antagonist in the human epidermal cell line SCL-II. Skin Pharmacol. 1993;6(2):148-51.
41	In vitro effects of E3040, a dual inhibitor of 5-lipoxygenase and thromboxane A(2) synthetase, on eicosanoid production. Eur J Pharmacol. 2001 Jun 22;422(1-3):209-16.
42	Effects of the new 5-lipoxygenase inhibitor E6080 on leukotriene release in vitro. Int Arch Allergy Immunol. 1992;97(4):267-73.
43	Selective blockade of leukotriene production by a single dose of the FPL 64170XX 0.5% enema in active ulcerative colitis. Pharmacol Toxicol. 1995 Dec;77(6):371-6.
44	Effects of TMK688, a novel anti-allergic drug, on allergic nasal obstruction and exudative responses in sensitized guinea pigs. Naunyn Schmiedebergs Arch Pharmacol. 1997 Dec;356(6):815-9.
45	Antileukotriene therapy for asthma. Am J Health Syst Pharm. 1996 Dec 1;53(23):2821-30; quiz 2877-8.
46	Inhibition of antigen-induced contraction of guinea-pig airways by a leukotriene synthesis inhibitor, BAY x1005. Eur J Pharmacol. 1994 Jun 2;258(1-2):95-102.
47	Inhibitory effects of MK-886 on arachidonic acid metabolism in human phagocytes. Br J Pharmacol. 1990 May;100(1):15-20.
48	Inflammation, Cancer and Oxidative Lipoxygenase Activity are Intimately Linked. Cancers (Basel) 2014 September; 6(3): 1500-1521.
49	Fuscoside: an anti-inflammatory marine natural product which selectively inhibits 5-lipoxygenase. Part II: Biochemical studies in the human neutrophil. J Pharmacol Exp Ther. 1992 Aug;262(2):874-82.
50	Topical R-85355, a potent and selective 5-lipoxygenase inhibitor, fails to improve psoriasis. Skin Pharmacol. 1996;9(5):307-11.
51	The immunosuppressive properties of enisoprost and a 5-lipoxygenase inhibitor (SC-45662). Transplantation. 1991 Dec;52(6):1053-7.
52	New cyclooxygenase-2/5-lipoxygenase inhibitors. 2. 7-tert-butyl-2,3-dihydro-3,3-dimethylbenzofuran derivatives as gastrointestinal safe antiinflamm... J Med Chem. 1998 Mar 26;41(7):1124-37.
53	Palladium catalyzed aryl(alkyl)thiolation of unactivated arenes. Org Lett. 2014 Feb 7;16(3):848-51.
54	Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
55	Cyclooxygenase (COX) and 5-lipoxygenase (5-LOX) selectivity of COX inhibitors. Prostaglandins Leukot Essent Fatty Acids. 2008 Feb;78(2):99-108.
56	Activity and potential role of licofelone in the management of osteoarthritis. Clin Interv Aging. 2007;2(1):73-9.
57	Licofelone, a dual COX/5-LOX inhibitor, induces apoptosis in HCA-7 colon cancer cells through the mitochondrial pathway independently from its abil... Carcinogenesis. 2008 Feb;29(2):371-80.
58	Licofelone (ML-3000), a dual inhibitor of 5-lipoxygenase and cyclooxygenase, reduces the level of cartilage chondrocyte death in vivo in experimental dog osteoarthritis: inhibition of pro-apoptotic factors. J Rheumatol. 2002 Jul;29(7):1446-53.
59	(+/-)-trans-2-[3-methoxy-4-(4-chlorophenylthioethoxy)-5-(N-methyl-N- hydroxyureidyl)methylphenyl]-5-(3,4, 5-trimethoxyphenyl)tetrahydrofuran (CMI-3... J Med Chem. 1998 May 21;41(11):1970-9.
60	The role of platelet-activating factor (PAF) and the efficacy of ABT-491, a highly potent and selective PAF antagonist, in experimental allergic rhinitis. J Pharmacol Exp Ther. 1998 Jan;284(1):83-8.
61	Stereoselective metabolism of the 5-lipoxygenase inhibitor A-78773. Ann N Y Acad Sci. 1994 Nov 15;744:262-73.
62	CA patent application no. 445634, Acne treatment comprising lipoxygenase inhibitors.
63	Platelets stimulate airway smooth muscle cell proliferation through mechanisms involving 5-lipoxygenase and reactive oxygen species. Platelets. 2008 Nov;19(7):528-36.
64	Leukotriene B4/leukotriene B4 receptor pathway is involved in hepatic microcirculatory dysfunction elicited by endotoxin. Shock. 2008 Jul;30(1):87-91.
65	Effect of 5-lipoxygenase inhibitor on experimental delayed cerebral vasospasm. Stroke. 1987 Mar-Apr;18(2):512-8.
66	Characterization and modulation of antigen-induced effects in isolated rat heart. J Cardiovasc Pharmacol. 1991 Oct;18(4):556-65.
67	A prodrug of a 2,6-disubstituted 4-(2-arylethenyl)phenol is a selective and orally active 5-lipoxygenase inhibitor. J Pharmacol Exp Ther. 1993 May;265(2):483-9.
68	5-Hydroxyanthranilic acid derivatives as potent 5-lipoxygenase inhibitors. J Antibiot (Tokyo). 1993 May;46(5):705-11.
69	Reactive oxygen species and lipoxygenases regulate the oncogenicity of NPM-ALK-positive anaplastic large cell lymphomas. Oncogene. 2009 Jul 23;28(29):2690-6.
70	Tumour necrosis factor production in a rat airpouch model of inflammation: role of eicosanoids. Agents Actions. 1991 Mar;32(3-4):289-94.
71	Hydroxamic acids and hydroxyureas as novel, selective 5-lipoxygenase inhibitors for possible use in asthma. Agents Actions Suppl. 1991;34:189-99.
72	Anti-inflammatory activity of Acanthus ilicifolius. J Ethnopharmacol. 2008 Oct 30;120(1):7-12.
73	Characterization of CGS 8515 as a selective 5-lipoxygenase inhibitor using in vitro and in vivo models. Biochim Biophys Acta. 1988 Apr 15;959(3):332-42.
74	CGS 26529: the biological profile of a novel, orally active 5-lipoxygenase inhibitor with an extended duration of action. Inflamm Res. 1995 Aug;44 Suppl 2:S147-8.
75	Role of leukotrienes on coronary vasoconstriction in isolated hearts of arthritic rats: effect of in vivo treatment with CI-986, a dual inhibitor of cyclooxygenase and lipoxygenase. Pharmacology. 2000 Jan;60(1):41-6.
76	DOI: 10.1016/0960-894X(95)00088-B
77	Epocarbazolins A and B, novel 5-lipoxygenase inhibitors. Taxonomy, fermentation, isolation, structures and biological activities. J Antibiot (Tokyo). 1993 Jan;46(1):25-33.
78	Improvement of dissolution and oral absorption of ER-34122, a poorly water-soluble dual 5-lipoxygenase/cyclooxygenase inhibitor with anti-inflammatory activity by preparing solid dispersion. J Pharm Sci. 2002 Jan;91(1):258-66.
79	ER-34122, a novel dual 5-lipoxygenase/cyclooxygenase inhibitor with potent anti-inflammatory activity in an arachidonic acid-induced ear inflammation model. Inflamm Res. 1998 Oct;47(10):375-83.
80	Synthesis, structure-activity relationships, and pharmacological evaluation of pyrrolo[3,2,1-ij]quinoline derivatives: potent histamine and platelet activating factor antagonism and 5-lipoxygenase inhibitory properties. Potential therapeutic application in asthma. J Med Chem. 1995 Feb 17;38(4):669-85.
81	WO patent application no. 2002,01223,5, 1,4-dihydropyridines as bradykinin antagonists.
82	Anti-inflammatory effects of LY221068 and LY269415. Agents Actions. 1991 Sep;34(1-2):100-2.
83	Design, synthesis, and 5-lipoxygenase-inhibiting properties of 1-thio-substituted butadienes. J Med Chem. 1990 Apr;33(4):1163-70.
84	A specific 15-lipoxygenase inhibitor limits the progression and monocyte-macrophage enrichment of hypercholesterolemia-induced atherosclerosis in the rabbit.Atherosclerosis.1998 Feb;136(2):203-16.
85	Mechanism-based inhibition of human liver microsomal cytochrome P450 1A2 by zileuton, a 5-lipoxygenase inhibitor. Drug Metab Dispos. 2003 Nov;31(11):1352-60.
86	Evaluation of the antiinflammatory activity of a dual cyclooxygenase-2 selective/5-lipoxygenase inhibitor, RWJ 63556, in a canine model of inflammation. J Pharmacol Exp Ther. 1997 Aug;282(2):1094-101.
87	Actions of a 5-lipoxygenase inhibitor, Sch 40120, on acute inflammatory responses. J Pharmacol Exp Ther. 1992 Aug;262(2):721-8.
88	WO patent application no. 2006,1317,37, Method and composition for treating inflammatory disorders.
89	Synthesis and antiinflammatory activity of certain 5,6,7,8-tetrahydroquinolines and related compounds. J Med Chem. 1995 Apr 28;38(9):1473-81.
90	CA patent application no. 445634, Acne treatment comprising lipoxygenase inhibitors.
91	Pharmacological nature of nicotine-induced contraction in the rat basilar artery: involvement of arachidonic acid metabolites. Eur J Pharmacol. 2007 Dec 22;577(1-3):109-14.
92	The anti-angiogenic effects of 1-furan-2-yl-3-pyridin-2-yl-propenone are mediated through the suppression of both VEGF production and VEGF-induced ... Vascul Pharmacol. 2009 Mar-Apr;50(3-4):123-31.
93	Cellular oxygenation of 12-hydroxyeicosatetraenoic acid and 15-hydroxyeicosatetraenoic acid by 5-lipoxygenase is stimulated by 5-lipoxygenase-activating protein. J Biol Chem. 1998 Dec 4;273(49):32842-7.
94	Hydroxamic acid inhibitors of 5-lipoxygenase: quantitative structure-activity relationships. J Med Chem. 1990 Mar;33(3):992-8.
95	Anti-inflammatory effects and gastrointestinal safety of NNU-hdpa, a novel dual COX/5-LOX inhibitor. Eur J Pharmacol. 2009 Jun 2;611(1-3):100-6.
96	4-hydroxythiazole inhibitors of 5-lipoxygenase. J Med Chem. 1991 Jul;34(7):2158-65.
97	Indole derivatives as potent inhibitors of 5-lipoxygenase: design, synthesis, biological evaluation, and molecular modeling. Bioorg Med Chem Lett. 2007 May 1;17(9):2414-20.
98	Synthesis and evaluation of benzoxazole derivatives as 5-lipoxygenase inhibitors. Bioorg Med Chem. 2010 Nov 1;18(21):7580-5.
99	Effect of 5-LOX/COX-2 common inhibitor DHDMBF30 on pancreatic cancer cell Capan2. World J Gastroenterol. 2008 Apr 28;14(16):2494-500.
100	Novel and known constituents from Buddleja species and their activity against leukocyte eicosanoid generation. J Nat Prod. 1999 Sep;62(9):1241-5.
101	Effect of BW B70C, a novel inhibitor of arachidonic acid 5-lipoxygenase, on allergen-induced bronchoconstriction and late-phase lung eosinophil accumulation in sensitised guinea-pigs. Agents Actions.1993 Jan;38(1-2):8-18.
102	Selective inhibition of arachidonate 5-lipoxygenase by novel acetohydroxamic acids: effects on bronchial anaphylaxis in anaesthetized guinea-pigs. Br J Pharmacol. 1988 Jun;94(2):540-6.
103	Inhibition of LTB4 biosynthesis in situ by CGS 23885, a potent 5-lipoxygenase inhibitor, correlates with its pleural fluid concentrations in an exp... Naunyn Schmiedebergs Arch Pharmacol. 1997 Apr;355(4):470-4.
104	Chebulagic acid, a COX-LOX dual inhibitor isolated from the fruits of Terminalia chebula Retz., induces apoptosis in COLO-205 cell line. J Ethnopharmacol. 2009 Jul 30;124(3):506-12.
105	Cylindol A, a novel biphenyl ether with 5-lipoxygenase inhibitory activity, and a related compound from Imperata Cylindrica. J Nat Prod. 1994 Sep;57(9):1290-3.
106	Studies on 5-lipoxygenase inhibitors. I. Synthesis and 5-lipoxygenase-inhibitory activity of novel hydroxamic acid derivatives. Chem Pharm Bull (Tokyo). 1998 Jun;46(6):966-72.
107	The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
108	Hyperforin is a dual inhibitor of cyclooxygenase-1 and 5-lipoxygenase. Biochem Pharmacol. 2002 Dec 15;64(12):1767-75.
109	DOI: 10.1517/13543776.2.11.1817
110	Pharmacology of the dual inhibitor of cyclooxygenase and 5-lipoxygenase 3-hydroxy-5-trifluoromethyl-N-(2-(2-thienyl)-2-phenyl-ethenyl)-benzo (b)thiophene-2-carboxamide. Arzneimittelforschung. 1988 Mar;38(3):372-8.
111	Nonsteroidal anti-inflammatory drugs as scaffolds for the design of 5-lipoxygenase inhibitors. J Med Chem. 1997 Feb 28;40(5):819-24.
112	Pharmacological characterization of SB 202235, a potent and selective 5-lipoxygenase inhibitor: effects in models of allergic asthma. J Pharmacol Exp Ther. 1995 Jun;273(3):1147-55.
113	Induction of apoptosis in blood cells from a patient with acute myelogenous leukemia by SC41661A, a selective inhibitor of 5-lipoxygenase. Prostaglandins Leukot Essent Fatty Acids. 1993 Apr;48(4):323-6.
114	Selective inhibition of 5-lipoxygenase attenuates glomerulonephritis in the rat. Kidney Int. 1994 May;45(5):1301-10.
115	Design of pyrrolo-1,4-benzoxazine derivatives as inhibitors of 5-lipoxygenase and PAF antagonists with anthihistaminic properties, Bioorg. Med. Chem. Lett. 4(20):2383-2388 (1994).
116	Omega-3 fatty acids and inflammatory processes. Nutrients. 2010 Mar;2(3):355-74.
117	Health implications of high dietary omega-6 polyunsaturated Fatty acids. J Nutr Metab. 2012;2012:539426.
118	A rat air pouch model for evaluating the efficacy and selectivity of 5-lipoxygenase inhibitors. Eur J Pharmacol. 2008 Apr 14;584(1):166-74.