Details of the Drug Therapeutic Target (DTT)

General Information of Drug Therapeutic Target (DTT) (ID: TT2J34L)

• DTT Name: Arachidonate 5-lipoxygenase (5-LOX)
• Synonyms: LOG5; 5-lipoxygenase; 5-LO
• Gene Name: ALOX5
• DTT Type: Successful target; [1]
• BioChemical Class: Oxygenase
• UniProt ID: LOX5_HUMAN
• TTD ID: T00140
• EC Number: EC 1.13.11.34
• Sequence:
  MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDE
  ELGEIQLVRIEKRKYWLNDDWYLKYITLKTPHGDYIEFPCYRWITGDVEVVLRDGRAKLA
  RDDQIHILKQHRRKELETRQKQYRWMEWNPGFPLSIDAKCHKDLPRDIQFDSEKGVDFVL
  NYSKAMENLFINRFMHMFQSSWNDFADFEKIFVKISNTISERVMNHWQEDLMFGYQFLNG
  CNPVLIRRCTELPEKLPVTTEMVECSLERQLSLEQEVQQGNIFIVDFELLDGIDANKTDP
  CTLQFLAAPICLLYKNLANKIVPIAIQLNQIPGDENPIFLPSDAKYDWLLAKIWVRSSDF
  HVHQTITHLLRTHLVSEVFGIAMYRQLPAVHPIFKLLVAHVRFTIAINTKAREQLICECG
  LFDKANATGGGGHVQMVQRAMKDLTYASLCFPEAIKARGMESKEDIPYYFYRDDGLLVWE
  AIRTFTAEVVDIYYEGDQVVEEDPELQDFVNDVYVYGMRGRKSSGFPKSVKSREQLSEYL
  TVVIFTASAQHAAVNFGQYDWCSWIPNAPPTMRAPPPTAKGVVTIEQIVDTLPDRGRSCW
  HLGAVWALSQFQENELFLGMYPEEHFIEKPVKEAMARFRKNLEAIVSVIAERNKKKQLPY
  YYLSPDRIPNSVAI
• Function: Catalyzes the first step in leukotriene biosynthesis, and thereby plays a role in inflammatory processes.
• KEGG Pathway:
  Arachidonic acid metabolism (hsa00590)
  Metabolic pathways (hsa01100)
  Serotonergic synapse (hsa04726)
  Ovarian steroidogenesis (hsa04913)
  Toxoplasmosis (hsa05145)
• Reactome Pathway:
  Synthesis of Leukotrienes (LT) and Eoxins (EX) (R-HSA-2142691)
  Synthesis of Lipoxins (LX) (R-HSA-2142700)
  Interleukin-4 and Interleukin-13 signaling (R-HSA-6785807)
  Neutrophil degranulation (R-HSA-6798695)
  Interleukin-18 signaling (R-HSA-9012546)
  Biosynthesis of D-series resolvins (R-HSA-9018676)
  Biosynthesis of maresins (R-HSA-9018682)
  Biosynthesis of E-series 18(S)-resolvins (R-HSA-9018896)
  Biosynthesis of aspirin-triggered D-series resolvins (R-HSA-9020265)
  Biosynthesis of E-series 18(R)-resolvins (R-HSA-9023661)
  Biosynthesis of DPAn-3-derived protectins and resolvins (R-HSA-9026286)
  Biosynthesis of DPAn-3-derived maresins (R-HSA-9026290)
  Biosynthesis of DPAn-3-derived 13-series resolvins (R-HSA-9026403)
  Biosynthesis of electrophilic Omega-3 PUFA oxo-derivatives (R-HSA-9027604)
  Synthesis of 5-eicosatetraenoic acids (R-HSA-2142688)
• BioCyc Pathway: MetaCyc:HS00336-MON

Molecular Interaction Atlas (MIA) of This DTT

4 Approved Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Diethylcarbamazine	DM1TJ8F	Elephantiasis		Approved	[1]
Zileuton	DMVRIC2	Allergic asthma	CA23.0	Approved	[2]
3,4-Dihydroxycinnamic Acid	DMVZL26	Thrombocytopenia	3B64	Phase 4	[3]
Silymarin	DMXBYQR	N. A.	N. A.	Phase 4	[4]

22 Clinical Trial Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
ABT-761	DM3FIC2	Asthma	CA23	Phase 3	[5]
Avastin+/-Tarceva	DMA86FL	Non-small-cell lung cancer	2C25.Y	Phase 3	[6]
Flobufen	DMPSG4D	Rheumatoid arthritis	FA20	Phase 3	[7]
FPL-62064	DMGF8MZ	Inflammation	1A00-CA43.1	Phase 3	[8]
Tenidap	DMHQRYE	Rheumatoid arthritis	FA20	Phase 3	[9]
Darbufelone	DMYVKM5	Asthma	CA23	Phase 2/3	[10]
BAICALEIN	DM4C7E6	Influenza virus infection	1E30-1E32	Phase 2	[11]
BIM23A760	DM6EIZG	Acromegaly	5A60.0	Phase 2	[12]
CMI-392	DM1NCUY	Psoriasis vulgaris	EA90	Phase 2	[13]
E-6700	DMUWJI4	Asthma	CA23	Phase 2	[14]
MK-866	DMQHS6B	Discovery agent	N.A.	Phase 2	[15]
PF-4191834	DM3DWKN	Asthma	CA23	Phase 2	[16]
PTC299	DMP9TKE	Rheumatoid arthritis	FA20	Phase 2	[17]
Q301	DME71WA	Atopic dermatitis	EA80	Phase 2	[18]
Rilopirox	DM3L51O	Fungal infection	1F29-1F2F	Phase 2	[19]
TA-270	DMZ7I51	Asthma	CA23	Phase 2	[20]
Tepoxalin	DMVS61L	Asthma	CA23	Phase 2	[21]
Tipelukast	DMS9BDQ	Asthma	CA23	Phase 2	[22]
UCB-35440	DM5Z34K	Rhinitis	FA20	Phase 2	[23]
WY-50295-tromethamine	DMFVNSB	Asthma	CA23	Phase 2	[24]
BF-389	DMHELFU	Rheumatoid arthritis	FA20	Phase 1	[25]
SKF-105809	DMUN7EQ	Pain	MG30-MG3Z	Phase 1	[26]

48 Discontinued Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Ibuproxam	DMSO2T9	Respiratory disease	CB40	Withdrawn from market	[27]
CJ-13610	DM1CDNS	Asthma	CA23	Discontinued in Phase 2	[28]
CV-6504	DMG3HX2	N. A.	N. A.	Discontinued in Phase 2	[29]
DuP-654	DMQ9IO0	Pruritus	EC90	Discontinued in Phase 2	[30]
E-3040	DM35KZG	Thrombosis	DB61-GB90	Discontinued in Phase 2	[31]
E-6080	DM296V7	Asthma	CA23	Discontinued in Phase 2	[32]
ETH615	DMEGMA2	Dermatitis	EA80-EA89	Discontinued in Phase 2	[12]
FPL-64170	DML6MVP	Psoriasis vulgaris	EA90	Discontinued in Phase 2	[33]
Linetastine	DMF8B62	Rhinitis	FA20	Discontinued in Phase 2	[12]
MK-591	DMVXTZG	Asthma	CA23	Discontinued in Phase 2	[34]
MK-886	DMT0O7H	Asthma	CA23	Discontinued in Phase 2	[35]
MLN-977	DMTWLG8	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 2	[36]
OPC-21268	DM7OVMH	Cardiac disease	BA00-BE2Z	Discontinued in Phase 2	[37]
R-68151	DM2NTJY	Psoriasis vulgaris	EA90	Discontinued in Phase 2	[12]
SC-45662	DMQ0T6L	Asthma	CA23	Discontinued in Phase 2	[38]
TEBUFELONE	DMMUE8P	Pain	MG30-MG3Z	Discontinued in Phase 2	[39]
AZD-4407	DM7XQTM	Chronic obstructive pulmonary disease	CA22	Discontinued in Phase 1	[40]
CD-581	DMOCBQW	Atopic dermatitis	EA80	Discontinued in Phase 1	[41]
Licofelone	DM7HLFD	Osteoarthritis	FA00-FA05	Discontinued in Phase 1	[42]
A-78773	DM4HRXI	Asthma	CA23	Terminated	[43]
A-79175	DMT5ZFG	Asthma	CA23	Terminated	[44]
A-80263	DM89BGE	Inflammation	1A00-CA43.1	Terminated	[45]
AA-861	DMPEB0Z	Allergy	4A80-4A85	Terminated	[46]
BI-L-357	DMBR48G	Asthma	CA23	Terminated	[47]
BU-4601A	DM4OT0S	Asthma	CA23	Terminated	[48]
BW A4C	DMNUMDG	Arthritis	FA20	Terminated	[49]
BW B70C	DMTYCJ6	Asthma	CA23	Terminated	[50]
BW755C	DMQM3P4	Inflammation	1A00-CA43.1	Terminated	[51]
CGS 8515	DMKUETX	N. A.	N. A.	Terminated	[52]
CGS-26529	DMJ4FGZ	Inflammation	1A00-CA43.1	Terminated	[53]
CI-986	DMI0TD8	Rheumatoid arthritis	FA20	Terminated	[54]
CMI-206	DMEIW7K	Inflammation	1A00-CA43.1	Terminated	[55]
Epocarbazolin-A	DMWRSXK	Asthma	CA23	Terminated	[56]
ER-34122	DMAZVUB	Inflammation	1A00-CA43.1	Terminated	[57]
KC-11404	DM3H90W	Asthma	CA23	Terminated	[58]
KC-11425	DMC295V	Asthma	CA23	Terminated	[59]
LY-221068	DMJ54E9	Arthritis	FA20	Terminated	[60]
NAFAZATROM	DM31CV2	N. A.	N. A.	Terminated	[61]
PD-146176	DMHQSF8	Arteriosclerosis	BD40	Terminated	[62]
R zileuton	DMA187T	Asthma	CA23	Terminated	[63]
R-85355	DMZQJVN	N. A.	N. A.	Terminated	[64]
REV-5901	DMI94L1	N. A.	N. A.	Terminated	[11]
RWJ-63556	DMUDE1T	Arthritis	FA20	Terminated	[65]
Sch-40120	DMXBJCY	Pruritus	EC90	Terminated	[66]
SKF-104351	DM8MWFZ	Rheumatoid arthritis	FA20	Terminated	[67]
WY-28342	DMAG86C	Rheumatoid arthritis	FA20	Terminated	[68]
ZD-7717	DMJEZOP	Asthma	CA23	Terminated	[69]
ZM-230487	DM0TBQK	Asthma	CA23	Terminated	[70]

115 Investigative Drug(s) Targeting This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
1,2-Dihydro-indazol-3-one	DM9G7DT	Discovery agent	N.A.	Investigative	[11]
1,2-Dihydroxy-10H-anthracen-9-one	DMASC8K	Discovery agent	N.A.	Investigative	[6]
1,3,8-Trihydroxy-6-methyl-10H-anthracen-9-one	DMRP03X	Discovery agent	N.A.	Investigative	[6]
1,5-Dihydroxy-10H-anthracen-9-one	DMC7FLT	Discovery agent	N.A.	Investigative	[6]
1,8,9-Trimethoxy-9,10-dihydro-anthracene	DMVHE1P	Discovery agent	N.A.	Investigative	[6]
1,8-Dichloro-10H-anthracen-9-one	DMZK4DL	Discovery agent	N.A.	Investigative	[6]
1,8-Dihydroxy-2-propionyl-10H-anthracen-9-one	DMDFBSX	Discovery agent	N.A.	Investigative	[6]
1-Benzyl-1,2-dihydro-indazol-3-one	DM17TIX	Discovery agent	N.A.	Investigative	[11]
1-furan-2-yl-3-pyridin-2-yl-propenone (FPP-3)	DM7UK56	Discovery agent	N.A.	Investigative	[71]
1-Hydroxy-10H-anthracen-9-one	DM235CQ	Discovery agent	N.A.	Investigative	[6]
1-Hydroxy-8-methoxy-10H-anthracen-9-one	DMRNO5U	Discovery agent	N.A.	Investigative	[6]
1-Methyl-1,2-dihydro-indazol-3-one	DM1BGQN	Discovery agent	N.A.	Investigative	[11]
10-Acetyl-1,8-dihydroxy-10H-anthracen-9-one	DM5BUXZ	Discovery agent	N.A.	Investigative	[6]
10-Benzoyl-1,8-dihydroxy-10H-anthracen-9-one	DM4M2VU	Discovery agent	N.A.	Investigative	[6]
15-hydroxyeicosatetraenoic acid	DMEML8B	Discovery agent	N.A.	Investigative	[12]
2'-Nitro-biphenyl-4-carboxylic acid hydroxyamide	DM2NX4K	Discovery agent	N.A.	Investigative	[72]
2-(1H-Indol-3-ylmethyl)-1,2-dihydro-indazol-3-one	DMB7AU5	Discovery agent	N.A.	Investigative	[11]
2-(3-Phenyl-propyl)-1,2-dihydro-indazol-3-one	DMIQBXD	Discovery agent	N.A.	Investigative	[11]
2-(4-Butoxy-phenoxy)-N-hydroxy-acetamide	DMG32HQ	Discovery agent	N.A.	Investigative	[72]
2-(4-Butoxy-phenoxy)-N-hydroxy-N-methyl-acetamide	DMEKNZW	Discovery agent	N.A.	Investigative	[72]
2-(4-Butoxy-phenoxy)-N-hydroxy-propionamide	DMO5IM0	Discovery agent	N.A.	Investigative	[72]
2-(4-Butoxy-phenyl)-N-hydroxy-N-methyl-acetamide	DMP7CF8	Discovery agent	N.A.	Investigative	[72]
2-(4-hydroxylphenyl)-3-(3,5-dihydroxylphenyl) propenoic acid (NNU-hdpa)	DMM4S1R	Discovery agent	N.A.	Investigative	[73]
2-(4-Methoxy-phenyl)-5-phenyl-thiazol-4-ol	DMZ9A6U	Discovery agent	N.A.	Investigative	[74]
2-(4-Phenyl-butyl)-1,2-dihydro-indazol-3-one	DMEQ063	Discovery agent	N.A.	Investigative	[11]
2-Benzyl-1,2-dihydro-indazol-3-one	DM1CB5J	Discovery agent	N.A.	Investigative	[11]
2-Biphenyl-4-yl-N-hydroxy-N-methyl-acetamide	DMWOJ5N	Discovery agent	N.A.	Investigative	[72]
2-Furan-2-ylmethyl-1,2-dihydro-indazol-3-one	DMQIRY7	Discovery agent	N.A.	Investigative	[11]
2-Methyl-1,2-dihydro-indazol-3-one	DMDJHFQ	Discovery agent	N.A.	Investigative	[11]
2-Naphthalen-1-ylmethyl-1,2-dihydro-indazol-3-one	DMIDGNB	Discovery agent	N.A.	Investigative	[11]
2-Naphthalen-2-ylmethyl-1,2-dihydro-indazol-3-one	DM1EJ6W	Discovery agent	N.A.	Investigative	[11]
2-Phenethyl-1,2-dihydro-indazol-3-one	DM0WMBC	Discovery agent	N.A.	Investigative	[11]
2-Phenyl-1,2-dihydro-indazol-3-one	DM28CLZ	Discovery agent	N.A.	Investigative	[11]
2-Pyridin-2-ylmethyl-1,2-dihydro-indazol-3-one	DMAS46B	Discovery agent	N.A.	Investigative	[11]
2-Pyridin-3-ylmethyl-1,2-dihydro-indazol-3-one	DMJYI0P	Discovery agent	N.A.	Investigative	[75]
2-Pyridin-4-ylmethyl-1,2-dihydro-indazol-3-one	DMGB1QU	Discovery agent	N.A.	Investigative	[11]
2-Thiazol-5-ylmethyl-1,2-dihydro-indazol-3-one	DM35JQS	Discovery agent	N.A.	Investigative	[11]
2-Thiophen-2-ylmethyl-1,2-dihydro-indazol-3-one	DM4J8B9	Discovery agent	N.A.	Investigative	[11]
3,4-Dihydroxy-10H-anthracen-9-one	DMG4NR3	Discovery agent	N.A.	Investigative	[6]
3-(4-Butoxy-phenyl)-N-hydroxy-N-methyl-acrylamide	DM8W3GC	Discovery agent	N.A.	Investigative	[72]
3-Benzoyl-N-hydroxy-benzamide	DM25K86	Discovery agent	N.A.	Investigative	[72]
3-Biphenyl-3-yl-N-hydroxy-N-methyl-acrylamide	DMHSAOQ	Discovery agent	N.A.	Investigative	[72]
3-Biphenyl-4-yl-N-hydroxy-N-methyl-acrylamide	DMKBRIM	Discovery agent	N.A.	Investigative	[72]
4,5-Dihydroxy-10H-anthracen-9-one	DMG8KRN	Discovery agent	N.A.	Investigative	[6]
4,5-Dimethoxy-10H-anthracen-9-one	DM34L89	Discovery agent	N.A.	Investigative	[6]
4-(1H-indol-3-yl)-1-morpholinobutan-1-one	DM9FKSM	Discovery agent	N.A.	Investigative	[76]
4-Bromo-N-hydroxy-benzamide	DMF38M5	Discovery agent	N.A.	Investigative	[72]
4-Butoxy-N-hydroxy-N-methyl-benzamide	DMFCB7L	Discovery agent	N.A.	Investigative	[72]
4-Hydroxy-5-methoxy-10H-anthracen-9-one	DMVFKSX	Discovery agent	N.A.	Investigative	[6]
4-Pentadeca-1,3,6-trienylsulfanyl-butyric acid	DMN1XMK	Discovery agent	N.A.	Investigative	[61]
5,8-Dihydroxy-1,4-naphthoquinone	DMOCEPA	Malaria	1F40-1F45	Investigative	[6]
5-Chloro-N-(4-ethylphenyl)benzo[d]oxazol-2-amine	DM2SKP7	Discovery agent	N.A.	Investigative	[77]
5-Chloro-N-phenylbenzo[d]oxazol-2-amine	DMVQLFB	Discovery agent	N.A.	Investigative	[77]
5-Methoxy-N-phenylbenzo[d]oxazol-2-amine	DM98EQX	Discovery agent	N.A.	Investigative	[77]
5-Methyl-2-p-tolyl-thiazol-4-ol	DMIE9BG	Discovery agent	N.A.	Investigative	[74]
5-Methyl-N-phenylbenzo[d]oxazol-2-amine	DMNJ0XZ	Discovery agent	N.A.	Investigative	[77]
5S-HETE	DM3Z6G4	Discovery agent	N.A.	Investigative	[12]
7-tert-butyl-2, 3-dihydro-3, 3-dimethyl substituted dihydrofuran 30 (DHDMBF30)	DMSU06X	Discovery agent	N.A.	Investigative	[78]
ACACETIN	DMQOB0X	Discovery agent	N.A.	Investigative	[79]
Acanthus ilicifolius Linn	DMZDFRI	Discovery agent	N.A.	Investigative	[51]
Acetic acid 2-phenyl-5-propyl-thiazol-4-yl ester	DMUYKIE	Discovery agent	N.A.	Investigative	[74]
Acetic acid 5-butyl-2-phenyl-thiazol-4-yl ester	DM95QEA	Discovery agent	N.A.	Investigative	[74]
Anthracene-2-carboxylic acid hydroxyamide	DMRC3OU	Discovery agent	N.A.	Investigative	[72]
ANTHRONE	DMWZ093	Discovery agent	N.A.	Investigative	[6]
Biphenyl-3-carboxylic acid hydroxyamide	DMROG71	Discovery agent	N.A.	Investigative	[72]
Biphenyl-4-carboxylic acid hydroxyamide	DMK5VYG	Discovery agent	N.A.	Investigative	[72]
BUDDLEDIN A	DMGFY4X	Discovery agent	N.A.	Investigative	[79]
BW A360C	DMNSLGC	Discovery agent	N.A.	Investigative	[50]
BW B218C	DMHQP84	Discovery agent	N.A.	Investigative	[50]
BW-858C	DMM2WPH	Asthma	CA23	Investigative	[80]
BW-A137C	DM7SNU0	Discovery agent	N.A.	Investigative	[81]
CGS-23885	DM5P7TR	Discovery agent	N.A.	Investigative	[82]
Chebulagic acid	DM0H7AV	Discovery agent	N.A.	Investigative	[83]
CYLINDOL A	DMTS8D5	Discovery agent	N.A.	Investigative	[84]
FR-122788	DMNMO83	Discovery agent	N.A.	Investigative	[85]
Heme	DMGC287	Discovery agent	N.A.	Investigative	[86]
Hexanoic acid 2,5-diphenyl-thiazol-4-yl ester	DM4U0L1	Discovery agent	N.A.	Investigative	[74]
Hyperforin	DM2L3PE	Discovery agent	N.A.	Investigative	[87]
ICI-211965	DMYRILU	Discovery agent	N.A.	Investigative	[88]
L-652,343	DMA23LP	Discovery agent	N.A.	Investigative	[89]
N-(2-Ethylphenyl)-5-methylbenzo[d]oxazol-2-amine	DMMDXEO	Discovery agent	N.A.	Investigative	[77]
N-(3-Bromophenyl)-5-methoxybenzo[d]oxazol-2-amine	DM0Z1HJ	Discovery agent	N.A.	Investigative	[77]
N-(4-Ethylphenyl)-5-methylbenzo[d]oxazol-2-amine	DMIWNAY	Discovery agent	N.A.	Investigative	[77]
N-(4-Ethylphenyl)benzo[d]oxazol-2-amine	DMJ73T6	Discovery agent	N.A.	Investigative	[77]
N-Hydroxy-2-methyl-3-naphthalen-2-yl-acrylamide	DME96RF	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-2-naphthalen-2-yl-acetamide	DMYDX34	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-3-naphthalen-2-yl-acrylamide	DMZ3INJ	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-3-naphthalen-2-yl-N-p-tolyl-acrylamide	DMKBACJ	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-3-naphthalen-2-yl-N-phenyl-acrylamide	DMVOPXE	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-3-naphthalen-2-yl-propionamide	DMPIMRC	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-3-phenyl-acrylamide	DM9IPTV	Discovery agent	N.A.	Investigative	[72]
N-hydroxy-4-(naphthalen-1-yl)benzamide	DMSHQE3	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-4-iodo-benzamide	DMEO7L5	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-4-isobutyl-benzamide	DM16G80	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-4-naphthalen-2-yl-benzamide	DMMHQE8	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-2,3,3-triphenyl-acrylamide	DMQ4ST2	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-2-naphthalen-2-yl-propionamide	DMNVD8I	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-3-naphthalen-1-yl-acrylamide	DMSRPI8	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-3-naphthalen-2-yl-acrylamide	DMANTW0	Discovery agent	N.A.	Investigative	[27]
N-Hydroxy-N-methyl-3-naphthalen-2-yl-propionamide	DMMYV34	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-3-phenanthren-2-yl-acrylamide	DMAN57F	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-3-phenanthren-3-yl-acrylamide	DMV8UCK	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-3-phenanthren-9-yl-acrylamide	DMQBD27	Discovery agent	N.A.	Investigative	[72]
N-Hydroxy-N-methyl-benzamide	DMDQWOB	Discovery agent	N.A.	Investigative	[72]
N-hydroxy-N-[1-(4-isobutylphenyl)ethyl]urea	DM4E8NJ	Discovery agent	N.A.	Investigative	[90]
N-Phenylbenzo[d]oxazol-2-amine	DMXANES	Discovery agent	N.A.	Investigative	[77]
Naphthalene-2-carboxylic acid hydroxyamide	DMG8A74	Discovery agent	N.A.	Investigative	[72]
Phenanthrene-2-carboxylic acid hydroxyamide	DMYT8UG	Discovery agent	N.A.	Investigative	[72]
Phenanthrene-3-carboxylic acid hydroxyamide	DMRYJBA	Discovery agent	N.A.	Investigative	[72]
PHENIDONE	DMJD8XN	Discovery agent	N.A.	Investigative	[84]
PYROGALLOL	DMG5KDY	Discovery agent	N.A.	Investigative	[6]
SB-202235	DM09UIS	Discovery agent	N.A.	Investigative	[91]
SC-41661A	DMCWZ84	Discovery agent	N.A.	Investigative	[92]
SK&F 107649	DMU1P3T	Discovery agent	N.A.	Investigative	[93]
TZI-41127	DMSI0HE	Discovery agent	N.A.	Investigative	[94]

Molecular Expression Atlas (MEA) of This DTT

Disease Name	ICD 11	Studied Tissue	p-value	Fold-Change	Z-score
Asthma	CA23	Nasal and bronchial airway	9.43E-03	0.14	0.28
Psoriasis	EA90	Skin	5.19E-01	-4.92E-03	-0.01
Rheumatoid arthritis	FA20	Synovial tissue	1.00E-02	0.55	2.11
Osteoarthritis	FA20	Synovial tissue	3.25E-01	-0.26	-0.47
Atopic dermatitis	EA90	Skin	2.96E-03	-0.22	-0.78
Chronic obstructive pulmonary disease	CA23	Lung tissue	7.42E-01	-0.18	-0.25
Chronic obstructive pulmonary disease	CA23	Small airway epithelium	1.25E-03	0.43	0.63
Coronary artery disease	BA80-BA8Z	Peripheral blood	4.99E-01	-0.11	-0.24
Prostate cancer	2C82	Prostate	4.15E-01	-0.06	-0.15
Sensitive skin	EA90	Skin	8.61E-01	0.08	0.38

The Drug-Metabolizing Enzyme (DME) Role of This DTT

• DTT DME Name: Arachidonate 5-lipoxygenase (ALOX5) DME Info
• Gene Name: ALOX5

1 Approved Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Epanova	DMHEAGL	Hypertriglyceridemia	5C80.1	Approved	[95]

1 Clinical Trial Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Omega-6-FA	DMBWY8V	N. A.	N. A.	Phase 3	[96]

1 Investigative Drug(s) Metabolized by This DTT

Drug Name	Drug ID	Indication	ICD 11	Highest Status	REF
Arachidonic Acid	DMUOQZD	Discovery agent	N.A.	Investigative	[97]

References

• [1] Inhibition of leukotriene formation by diethylcarbamazine modifies the acid-base balance in the rabbits with blast injuries of the lungs. Vojnosanit Pregl. 1999 May-Jun;56(3):243-7.
• [2] 5-lipoxygenase inhibitor zileuton attenuates ischemic brain damage: involvement of matrix metalloproteinase 9. Neurol Res. 2009 Oct;31(8):848-52.
• [3] Phenidone protects the nigral dopaminergic neurons from LPS-induced neurotoxicity. Neurosci Lett. 2008 Nov 7;445(1):1-6.
• [4] Anti-inflammatory and anti-arthritic activities of silymarin acting through inhibition of 5-lipoxygenase. Phytomedicine. 2000 Mar;7(1):21-4.
• [5] Treatment with 5-lipoxygenase inhibitor VIA-2291 (Atreleuton) in patients with recent acute coronary syndrome. Circ Cardiovasc Imaging. 2010 May;3(3):298-307.
• [6] Simple analogues of anthralin: unusual specificity of structure and antiproliferative activity. J Med Chem. 1997 Nov 7;40(23):3773-80.
• [7] Pharmacological profile of the novel potent antirheumatic 4-(2',4'-difluorobiphenyl-4-yl)-2-methyl-4-oxobutanoic acid. Arzneimittelforschung. 1997 May;47(5):648-52.
• [8] FPL 62064, a topically active 5-lipoxygenase/cyclooxygenase inhibitor. Agents Actions. 1990 Jun;30(3-4):432-42.
• [9] The in vitro free radical scavenging activity of tenidap, a new dual cyclo-oxygenase and 5-1ipoxygenase inhibitor. Mediators Inflamm. 1992;1(2):141-3.
• [10] Novel dual cyclooxygenase and lipoxygenase inhibitors targeting hyaluronan-CD44v6 pathway and inducing cytotoxicity in colon cancer cells. Bioorg Med Chem. 2013 May 1;21(9):2551-9.
• [11] Indazolinones, a new series of redox-active 5-lipoxygenase inhibitors with built-in selectivity and oral activity. J Med Chem. 1991 Mar;34(3):1028-36.
• [12] Preview of potential therapeutic applications of leukotriene B4 inhibitors in dermatology. Skin Pharmacol Appl Skin Physiol. 2000 Sep-Oct;13(5):235-45.
• [13] Anti-inflammatory activities of LDP-392, a dual PAF receptor antagonist and 5-lipoxygenase inhibitor. Pharmacol Res. 2001 Sep;44(3):213-20.
• [14] Structure-activity relationships of (E)-3-(1,4-benzoquinonyl)-2-[(3-pyridyl)-alkyl]-2-propenoic acid derivatives that inhibit both 5-lipoxygenase and thromboxane A2 synthetase. J Med Chem. 1996 Aug 2;39(16):3148-57.
• [15] Inhibition of leukotriene synthesis with MK-886 prevents a rise in blood pressure and reduces noradrenaline-evoked contraction in L-NAME-treated rats
• [16] Pharmacology of PF-4191834, a novel, selective non-redox 5-lipoxygenase inhibitor effective in inflammation and pain. J Pharmacol Exp Ther. 2010 Jul;334(1):294-301.
• [17] Therapeutic intervention in a rat model of ARDS: I. Dual inhibition of arachidonic acid metabolism. Circ Shock. 1990 Nov;32(3):231-42.
• [18] Clinical pipeline report, company report or official report of Qurient.
• [19] Therapy of seborrheic eczema with an antifungal agent with an antiphlogistic effect. Mycoses. 1991;34 Suppl 1:91-3.
• [20] TA-270 [4-hydroxy-1-methyl-3-octyloxy-7-sinapinoylamino-2(1H)-quinolinone], an anti-asthmatic agent, inhibits leukotriene production induced by IgE... J Pharmacol Exp Ther. 2003 Nov;307(2):583-8.
• [21] Preclinical toxicity evaluation of tepoxalin, a dual inhibitor of cyclooxygenase and 5-lipoxygenase, in Sprague-Dawley rats and beagle dogs. Fundam Appl Toxicol. 1996 Sep;33(1):38-48.
• [22] Company report (MediciNova)
• [23] The effect of a novel, dual function histamine H1 receptor antagonist/5-lipoxygenase enzyme inhibitor on in vivo dermal inflammation and extravasat... Eur J Pharmacol. 2005 Jan 4;506(3):265-71.
• [24] WY-50295 tromethamine: a 5-lipoxygenase inhibitor without activity in human whole blood. Prostaglandins Leukot Essent Fatty Acids. 1999 Jan;60(1):31-41.
• [25] Antiarthritic profile of BF-389--a novel anti-inflammatory agent with low ulcerogenic liability. Agents Actions. 1992 Sep;37(1-2):90-8.
• [26] Analgetic activity of SK&F 105809, a dual inhibitor of arachidonic acid metabolism. Agents Actions Suppl. 1991;32:113-7.
• [27] In vivo characterization of hydroxamic acid inhibitors of 5-lipoxygenase. J Med Chem. 1987 Nov;30(11):2121-6.
• [28] Emerging drugs for the treatment of chronic obstructive pulmonary disease. Expert Opin Emerg Drugs. 2006 May;11(2):275-91.
• [29] A phase II study of the 5-lipoxygenase inhibitor, CV6504, in advanced pancreatic cancer: correlation of clinical data with pharmacokinetic and pharmacodynamic endpoints. Ann Oncol. 2000 Sep;11(9):1165-70.
• [30] The lipoxygenase inhibitor 2-phenylmethyl-1-naphthol (DuP 654) is a 12(S)-hydroxyeicosatetraenoic acid receptor antagonist in the human epidermal cell line SCL-II. Skin Pharmacol. 1993;6(2):148-51.
• [31] In vitro effects of E3040, a dual inhibitor of 5-lipoxygenase and thromboxane A(2) synthetase, on eicosanoid production. Eur J Pharmacol. 2001 Jun 22;422(1-3):209-16.
• [32] Effects of the new 5-lipoxygenase inhibitor E6080 on leukotriene release in vitro. Int Arch Allergy Immunol. 1992;97(4):267-73.
• [33] Selective blockade of leukotriene production by a single dose of the FPL 64170XX 0.5% enema in active ulcerative colitis. Pharmacol Toxicol. 1995 Dec;77(6):371-6.
• [34] Antileukotriene therapy for asthma. Am J Health Syst Pharm. 1996 Dec 1;53(23):2821-30; quiz 2877-8.
• [35] Inhibitory effects of MK-886 on arachidonic acid metabolism in human phagocytes. Br J Pharmacol. 1990 May;100(1):15-20.
• [36] Inflammation, Cancer and Oxidative Lipoxygenase Activity are Intimately Linked. Cancers (Basel) 2014 September; 6(3): 1500-1521.
• [37] Fuscoside: an anti-inflammatory marine natural product which selectively inhibits 5-lipoxygenase. Part II: Biochemical studies in the human neutrophil. J Pharmacol Exp Ther. 1992 Aug;262(2):874-82.
• [38] The immunosuppressive properties of enisoprost and a 5-lipoxygenase inhibitor (SC-45662). Transplantation. 1991 Dec;52(6):1053-7.
• [39] New cyclooxygenase-2/5-lipoxygenase inhibitors. 2. 7-tert-butyl-2,3-dihydro-3,3-dimethylbenzofuran derivatives as gastrointestinal safe antiinflamm... J Med Chem. 1998 Mar 26;41(7):1124-37.
• [40] Palladium catalyzed aryl(alkyl)thiolation of unactivated arenes. Org Lett. 2014 Feb 7;16(3):848-51.
• [41] Drugs@FDA. U.S. Food and Drug Administration. U.S. Department of Health & Human Services. 2015
• [42] Cyclooxygenase (COX) and 5-lipoxygenase (5-LOX) selectivity of COX inhibitors. Prostaglandins Leukot Essent Fatty Acids. 2008 Feb;78(2):99-108.
• [43] (+/-)-trans-2-[3-methoxy-4-(4-chlorophenylthioethoxy)-5-(N-methyl-N- hydroxyureidyl)methylphenyl]-5-(3,4, 5-trimethoxyphenyl)tetrahydrofuran (CMI-3... J Med Chem. 1998 May 21;41(11):1970-9.
• [44] The role of platelet-activating factor (PAF) and the efficacy of ABT-491, a highly potent and selective PAF antagonist, in experimental allergic rhinitis. J Pharmacol Exp Ther. 1998 Jan;284(1):83-8.
• [45] CA patent application no. 445634, Acne treatment comprising lipoxygenase inhibitors.
• [46] Platelets stimulate airway smooth muscle cell proliferation through mechanisms involving 5-lipoxygenase and reactive oxygen species. Platelets. 2008 Nov;19(7):528-36.
• [47] A prodrug of a 2,6-disubstituted 4-(2-arylethenyl)phenol is a selective and orally active 5-lipoxygenase inhibitor. J Pharmacol Exp Ther. 1993 May;265(2):483-9.
• [48] 5-Hydroxyanthranilic acid derivatives as potent 5-lipoxygenase inhibitors. J Antibiot (Tokyo). 1993 May;46(5):705-11.
• [49] Reactive oxygen species and lipoxygenases regulate the oncogenicity of NPM-ALK-positive anaplastic large cell lymphomas. Oncogene. 2009 Jul 23;28(29):2690-6.
• [50] Hydroxamic acids and hydroxyureas as novel, selective 5-lipoxygenase inhibitors for possible use in asthma. Agents Actions Suppl. 1991;34:189-99.
• [51] Anti-inflammatory activity of Acanthus ilicifolius. J Ethnopharmacol. 2008 Oct 30;120(1):7-12.
• [52] Characterization of CGS 8515 as a selective 5-lipoxygenase inhibitor using in vitro and in vivo models. Biochim Biophys Acta. 1988 Apr 15;959(3):332-42.
• [53] CGS 26529: the biological profile of a novel, orally active 5-lipoxygenase inhibitor with an extended duration of action. Inflamm Res. 1995 Aug;44 Suppl 2:S147-8.
• [54] Role of leukotrienes on coronary vasoconstriction in isolated hearts of arthritic rats: effect of in vivo treatment with CI-986, a dual inhibitor of cyclooxygenase and lipoxygenase. Pharmacology. 2000 Jan;60(1):41-6.
• [55] DOI: 10.1016/0960-894X(95)00088-B
• [56] Epocarbazolins A and B, novel 5-lipoxygenase inhibitors. Taxonomy, fermentation, isolation, structures and biological activities. J Antibiot (Tokyo). 1993 Jan;46(1):25-33.
• [57] Improvement of dissolution and oral absorption of ER-34122, a poorly water-soluble dual 5-lipoxygenase/cyclooxygenase inhibitor with anti-inflammatory activity by preparing solid dispersion. J Pharm Sci. 2002 Jan;91(1):258-66.
• [58] Synthesis, structure-activity relationships, and pharmacological evaluation of pyrrolo[3,2,1-ij]quinoline derivatives: potent histamine and platelet activating factor antagonism and 5-lipoxygenase inhibitory properties. Potential therapeutic application in asthma. J Med Chem. 1995 Feb 17;38(4):669-85.
• [59] WO patent application no. 2002,01223,5, 1,4-dihydropyridines as bradykinin antagonists.
• [60] Anti-inflammatory effects of LY221068 and LY269415. Agents Actions. 1991 Sep;34(1-2):100-2.
• [61] Design, synthesis, and 5-lipoxygenase-inhibiting properties of 1-thio-substituted butadienes. J Med Chem. 1990 Apr;33(4):1163-70.
• [62] A specific 15-lipoxygenase inhibitor limits the progression and monocyte-macrophage enrichment of hypercholesterolemia-induced atherosclerosis in the rabbit.Atherosclerosis.1998 Feb;136(2):203-16.
• [63] Mechanism-based inhibition of human liver microsomal cytochrome P450 1A2 by zileuton, a 5-lipoxygenase inhibitor. Drug Metab Dispos. 2003 Nov;31(11):1352-60.
• [64] Topical R-85355, a potent and selective 5-lipoxygenase inhibitor, fails to improve psoriasis. Skin Pharmacol. 1996;9(5):307-11.
• [65] Evaluation of the antiinflammatory activity of a dual cyclooxygenase-2 selective/5-lipoxygenase inhibitor, RWJ 63556, in a canine model of inflammation. J Pharmacol Exp Ther. 1997 Aug;282(2):1094-101.
• [66] Actions of a 5-lipoxygenase inhibitor, Sch 40120, on acute inflammatory responses. J Pharmacol Exp Ther. 1992 Aug;262(2):721-8.
• [67] WO patent application no. 2006,1317,37, Method and composition for treating inflammatory disorders.
• [68] Synthesis and antiinflammatory activity of certain 5,6,7,8-tetrahydroquinolines and related compounds. J Med Chem. 1995 Apr 28;38(9):1473-81.
• [69] CA patent application no. 445634, Acne treatment comprising lipoxygenase inhibitors.
• [70] Pharmacological nature of nicotine-induced contraction in the rat basilar artery: involvement of arachidonic acid metabolites. Eur J Pharmacol. 2007 Dec 22;577(1-3):109-14.
• [71] The anti-angiogenic effects of 1-furan-2-yl-3-pyridin-2-yl-propenone are mediated through the suppression of both VEGF production and VEGF-induced ... Vascul Pharmacol. 2009 Mar-Apr;50(3-4):123-31.
• [72] Hydroxamic acid inhibitors of 5-lipoxygenase: quantitative structure-activity relationships. J Med Chem. 1990 Mar;33(3):992-8.
• [73] Anti-inflammatory effects and gastrointestinal safety of NNU-hdpa, a novel dual COX/5-LOX inhibitor. Eur J Pharmacol. 2009 Jun 2;611(1-3):100-6.
• [74] 4-hydroxythiazole inhibitors of 5-lipoxygenase. J Med Chem. 1991 Jul;34(7):2158-65.
• [75] Tumour necrosis factor production in a rat airpouch model of inflammation: role of eicosanoids. Agents Actions. 1991 Mar;32(3-4):289-94.
• [76] Indole derivatives as potent inhibitors of 5-lipoxygenase: design, synthesis, biological evaluation, and molecular modeling. Bioorg Med Chem Lett. 2007 May 1;17(9):2414-20.
• [77] Synthesis and evaluation of benzoxazole derivatives as 5-lipoxygenase inhibitors. Bioorg Med Chem. 2010 Nov 1;18(21):7580-5.
• [78] Effect of 5-LOX/COX-2 common inhibitor DHDMBF30 on pancreatic cancer cell Capan2. World J Gastroenterol. 2008 Apr 28;14(16):2494-500.
• [79] Novel and known constituents from Buddleja species and their activity against leukocyte eicosanoid generation. J Nat Prod. 1999 Sep;62(9):1241-5.
• [80] Effect of BW B70C, a novel inhibitor of arachidonic acid 5-lipoxygenase, on allergen-induced bronchoconstriction and late-phase lung eosinophil accumulation in sensitised guinea-pigs. Agents Actions.1993 Jan;38(1-2):8-18.
• [81] Selective inhibition of arachidonate 5-lipoxygenase by novel acetohydroxamic acids: effects on bronchial anaphylaxis in anaesthetized guinea-pigs. Br J Pharmacol. 1988 Jun;94(2):540-6.
• [82] Inhibition of LTB4 biosynthesis in situ by CGS 23885, a potent 5-lipoxygenase inhibitor, correlates with its pleural fluid concentrations in an exp... Naunyn Schmiedebergs Arch Pharmacol. 1997 Apr;355(4):470-4.
• [83] Chebulagic acid, a COX-LOX dual inhibitor isolated from the fruits of Terminalia chebula Retz., induces apoptosis in COLO-205 cell line. J Ethnopharmacol. 2009 Jul 30;124(3):506-12.
• [84] Cylindol A, a novel biphenyl ether with 5-lipoxygenase inhibitory activity, and a related compound from Imperata Cylindrica. J Nat Prod. 1994 Sep;57(9):1290-3.
• [85] Studies on 5-lipoxygenase inhibitors. I. Synthesis and 5-lipoxygenase-inhibitory activity of novel hydroxamic acid derivatives. Chem Pharm Bull (Tokyo). 1998 Jun;46(6):966-72.
• [86] The Protein Data Bank. Nucleic Acids Res. 2000 Jan 1;28(1):235-42.
• [87] Hyperforin is a dual inhibitor of cyclooxygenase-1 and 5-lipoxygenase. Biochem Pharmacol. 2002 Dec 15;64(12):1767-75.
• [88] DOI: 10.1517/13543776.2.11.1817
• [89] Pharmacology of the dual inhibitor of cyclooxygenase and 5-lipoxygenase 3-hydroxy-5-trifluoromethyl-N-(2-(2-thienyl)-2-phenyl-ethenyl)-benzo (b)thiophene-2-carboxamide. Arzneimittelforschung. 1988 Mar;38(3):372-8.
• [90] Nonsteroidal anti-inflammatory drugs as scaffolds for the design of 5-lipoxygenase inhibitors. J Med Chem. 1997 Feb 28;40(5):819-24.
• [91] Pharmacological characterization of SB 202235, a potent and selective 5-lipoxygenase inhibitor: effects in models of allergic asthma. J Pharmacol Exp Ther. 1995 Jun;273(3):1147-55.
• [92] Induction of apoptosis in blood cells from a patient with acute myelogenous leukemia by SC41661A, a selective inhibitor of 5-lipoxygenase. Prostaglandins Leukot Essent Fatty Acids. 1993 Apr;48(4):323-6.
• [93] Selective inhibition of 5-lipoxygenase attenuates glomerulonephritis in the rat. Kidney Int. 1994 May;45(5):1301-10.
• [94] Design of pyrrolo-1,4-benzoxazine derivatives as inhibitors of 5-lipoxygenase and PAF antagonists with anthihistaminic properties, Bioorg. Med. Chem. Lett. 4(20):2383-2388 (1994).
• [95] Omega-3 fatty acids and inflammatory processes. Nutrients. 2010 Mar;2(3):355-74.
• [96] Health implications of high dietary omega-6 polyunsaturated Fatty acids. J Nutr Metab. 2012;2012:539426.
• [97] A rat air pouch model for evaluating the efficacy and selectivity of 5-lipoxygenase inhibitors. Eur J Pharmacol. 2008 Apr 14;584(1):166-74.