Details of Drug-Metabolizing Enzyme (DME)

General Information of Drug-Metabolizing Enzyme (DME) (ID: DE9QHP6)

DME Name Cytochrome P450 1B1 (CYP1B1)
Synonyms Cytochrome P450 family 1 subfamily B member 1; P450 1B1; CP1B; GLC3A; P4501B1; ASGD6; CYP1B1; CYPIB1
Gene Name CYP1B1
UniProt ID
CP1B1_HUMAN
INTEDE ID
DME0023
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Gene ID
1545
EC Number EC: 1.14.14.1
Oxidoreductase
Oxygen paired donor oxidoreductase
Flavin/flavoprotein donor oxidoreductase
EC: 1.14.14.1
Lineage Species: Homo sapiens
Kingdom: Metazoa
Phylum: Chordata
Class: Mammalia
Order: Primates
Family: Hominidae
Genus: Homo
Species: Homo sapiens
Sequence
MGTSLSPNDPWPLNPLSIQQTTLLLLLSVLATVHVGQRLLRQRRRQLRSAPPGPFAWPLI
GNAAAVGQAAHLSFARLARRYGDVFQIRLGSCPIVVLNGERAIHQALVQQGSAFADRPAF
ASFRVVSGGRSMAFGHYSEHWKVQRRAAHSMMRNFFTRQPRSRQVLEGHVLSEARELVAL
LVRGSADGAFLDPRPLTVVAVANVMSAVCFGCRYSHDDPEFRELLSHNEEFGRTVGAGSL
VDVMPWLQYFPNPVRTVFREFEQLNRNFSNFILDKFLRHCESLRPGAAPRDMMDAFILSA
EKKAAGDSHGGGARLDLENVPATITDIFGASQDTLSTALQWLLLLFTRYPDVQTRVQAEL
DQVVGRDRLPCMGDQPNLPYVLAFLYEAMRFSSFVPVTIPHATTANTSVLGYHIPKDTVV
FVNQWSVNHDPLKWPNPENFDPARFLDKDGLINKDLTSRVMIFSVGKRRCIGEELSKMQL
FLFISILAHQCDFRANPNEPAKMNFSYGLTIKPKSFKVNVTLRESMELLDSAVQNLQAKE
TCQ
Function
This enzyme is involved in the metabolism of various endogenous substrates, including fatty acids, steroid hormones and vitamins. It exhibits catalytic activity for the formation of hydroxyestrogens from estrone (E1) and 17beta-estradiol (E2), namely 2- and 4-hydroxy E1 and E2 and displays a predominant hydroxylase activity toward E2 at the C-4 position. It metabolizes testosterone and progesterone to B or D ring hydroxylated metabolites. It catalyzes the epoxidation of double bonds of certain PUFA; converts arachidonic acid toward epoxyeicosatrienoic acid (EpETrE) regioisomers, 8,9-, 11,12-, and 14,15- EpETrE. Additionally, it displays dehydratase activity toward oxygenated eicosanoids hydroperoxyeicosatetraenoates (HpETEs). Also it is involved in the oxidative metabolism of xenobiotics, particularly converting polycyclic aromatic hydrocarbons and heterocyclic aryl amines procarcinogens to DNA-damaging products.
KEGG Pathway
Chemical carcinogenesis (hsa05204 )
Metabolism of xenobiotics by cytochrome P450 (hsa00980 )
MicroRNAs in cancer (hsa05206 )
Ovarian steroidogenesis (hsa04913 )
Steroid hormone biosynthesis (hsa00140 )
Tryptophan metabolism (hsa00380 )
Reactome Pathway
Endogenous sterols (R-HSA-211976 )
Synthesis of (16-20)-hydroxyeicosatetraenoic acids (HETE) (R-HSA-2142816 )
Synthesis of epoxy (EET) and dihydroxyeicosatrienoic acids (DHET) (R-HSA-2142670 )
Defective CYP1B1 causes Glaucoma (R-HSA-5579000 )

Molecular Interaction Atlas (MIA) of This DME

Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DME
15 Approved Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Amodiaquine DME4RA8 Malaria 1F40-1F45 Approved [3]
Caffeine DMKBJWP Orthostatic hypotension BA21 Approved [4]
Erythromycin DM4K7GQ Bacterial infection 1A00-1C4Z Approved [5]
Estradiol DMUNTE3 Breast cancer 2C60-2C65 Approved [6]
Estrone DM5T6US Menopausal and postmenopausal disorder GA30 Approved [7]
Flutamide DMK0O7U Prostate cancer 2C82.0 Approved [8]
Hydrogen peroxide DM1NG5W Infectious disease 1A00-CA43.1 Approved [9]
Melatonin DMKWFBT Insomnia 7A00-7A0Z Approved [10]
Oxaliplatin DMQNWRD Colorectal cancer 2B91.Z Approved [11]
Procarbazine DMIK367 Hodgkin lymphoma 2B30 Approved [12]
Progesterone DMUY35B Premature labour JB00 Approved [13]
Rosuvastatin DMMIQ7G Hypercholesterolaemia 5C80.0 Approved [14]
Testosterone cypionate DMC1TEV Testosterone deficiency 5A81.1 Approved [13]
Theophylline DMRJFN9 Chronic obstructive pulmonary disease CA22 Approved [4]
Vitamin A DMJ2AH4 Night blindness 9D45 Approved [15]
⏷ Show the Full List of 15 Approved Drug(s)
1 Clinical Trial Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
5-methoxypsoralen DME2A8X Psoriasis vulgaris EA90 Phase 3 [16]
1 Investigative Drug(s) Metabolized by This DME
Drug Name Drug ID Indication ICD 11 Highest Status REF
Dibutyl phthalate DMEDGKO Discovery agent N.A. Investigative [17]

Molecular Expression Atlas (MEA) of This DME

Molecular Expression Atlas (MEA) Jump to Detail Molecular Expression Atlas of This DME
Disease Name ICD 11 Studied Tissue p-value Fold-Change Z-score
Acute myelocytic leukaemia 2B33.1 Bone marrow 1.80E-10 -1.64E+00 -1.44E+00
Alopecia ED70 Skin from scalp 1.79E-05 -7.57E-01 -1.09E+00
Alzheimer's disease 8A20 Entorhinal cortex 6.14E-01 -4.44E-02 -6.61E-02
Ankylosing spondylitis FA92.0 Pheripheral blood 7.13E-01 -1.93E-01 -5.50E-01
Aortic stenosis BB70 Calcified aortic valve 7.03E-01 6.52E-01 5.68E-01
Apnea 7A40 Hyperplastic tonsil 7.00E-01 1.21E-01 1.96E-01
Arthropathy FA00-FA5Z Peripheral blood 3.91E-01 8.39E-01 1.20E+00
Asthma CA23 Nasal and bronchial airway 8.90E-06 1.48E+00 8.91E-01
Atopic dermatitis EA80 Skin 3.69E-01 2.00E-01 4.10E-01
Autism 6A02 Whole blood 3.00E-02 1.99E-01 3.13E-01
Autoimmune uveitis 9A96 Peripheral monocyte 8.01E-01 -1.16E+00 -5.99E-01
Autosomal dominant monocytopenia 4B04 Whole blood 2.92E-03 1.42E+00 1.49E+00
Bacterial infection of gingival 1C1H Gingival tissue 7.97E-06 5.55E-01 7.19E-01
Batten disease 5C56.1 Whole blood 5.62E-01 3.62E-01 4.91E-01
Behcet's disease 4A62 Peripheral blood 5.09E-01 2.19E-01 4.73E-01
Bipolar disorder 6A60-6A6Z Prefrontal cortex 3.50E-01 6.10E-02 1.74E-01
Bladder cancer 2C94 Bladder tissue 1.19E-07 -2.50E+00 -4.47E+00
Breast cancer 2C60-2C6Z Breast tissue 8.78E-01 -7.67E-02 -8.45E-02
Cardioembolic stroke 8B11.20 Whole blood 1.85E-06 6.07E-01 1.46E+00
Cervical cancer 2C77 Cervical tissue 8.70E-01 -7.48E-02 -7.02E-02
Childhood onset rheumatic disease FA20.Z Peripheral blood 4.78E-01 -1.78E-01 -1.26E-01
Chronic hepatitis C 1E51.1 Whole blood 6.72E-01 -9.77E-01 -3.24E-01
Chronic obstructive pulmonary disease CA22 Lung tissue 3.96E-01 2.30E-02 2.41E-02
Chronic obstructive pulmonary disease CA22 Small airway epithelium 2.67E-10 3.93E+00 1.53E+00
Chronic rhinosinusitis CA0A Sinus mucosa tissue 8.93E-01 -2.44E-02 -1.81E-02
Colon cancer 2B90 Colon tissue 2.27E-19 1.44E-01 2.37E-01
Coronary artery disease BA80-BA8Z Peripheral blood 3.41E-01 -6.79E-01 -4.93E-01
Diffuse large B-cell lymphoma 2A81 Tonsil tissue 9.93E-01 9.88E-02 1.17E-01
Endometriosis GA10 Endometrium tissue 8.33E-01 9.54E-03 5.28E-03
Familial hypercholesterolemia 5C80.00 Peripheral blood 1.17E-01 -5.79E-01 -4.66E-01
Familial hypercholesterolemia 5C80.00 Whole blood 1.27E-09 2.24E+00 2.07E+00
Gastric cancer 2B72 Gastric tissue 7.42E-01 5.18E-01 2.07E-01
Glioblastopma 2A00.00 Nervous tissue 3.72E-05 2.34E-01 2.08E-01
Glioma 2A00.0Y-2A00.0Z Brain stem tissue 5.71E-02 -2.77E+00 -4.33E+00
Glioma 2A00.0Y-2A00.0Z White matter tissue 1.52E-02 2.25E+00 1.29E+00
Head and neck cancer 2D42 Head and neck tissue 1.99E-01 1.15E+00 5.01E-01
HIV-associated neurocognitive impairment 8A2Y-8A2Z White matter tissue 1.05E-04 4.62E-01 1.17E+00
Huntington's disease 8A01.10 Whole blood 5.87E-01 -3.32E-01 -2.53E-01
Idiopathic pulmonary fibrosis CB03.4 Lung tissue 8.87E-01 3.98E-01 4.56E-01
Immunodeficiency 4A00-4A20 Peripheral blood 8.67E-01 -2.18E-02 -1.72E-01
Influenza 1E30 Whole blood 5.14E-03 -1.56E+00 -3.49E+00
Interstitial cystitis GC00.3 Bladder tissue 7.66E-02 -1.21E+00 -1.79E+00
Intracranial aneurysm 8B01.0 Intracranial artery 4.61E-03 1.95E+00 1.97E+00
Irritable bowel syndrome DD91.0 Rectal colon tissue 6.64E-02 1.45E-01 1.92E-01
Ischemic stroke 8B11 Peripheral blood 8.90E-01 -2.26E-01 -2.85E-01
Juvenile idiopathic arthritis FA24 Peripheral blood 3.51E-08 5.69E-01 6.15E-01
Lateral sclerosis 8B60.4 Skin 6.49E-01 -9.59E-01 -4.54E-01
Lateral sclerosis 8B60.4 Cervical spinal cord 3.38E-01 -5.36E-01 -3.76E-01
Liver cancer 2C12.0 Liver tissue 4.27E-01 2.43E-01 2.46E-01
Liver failure DB99.7-DB99.8 Liver tissue 5.82E-02 7.06E-01 1.50E+00
Lung cancer 2C25 Lung tissue 2.26E-01 2.14E-01 2.29E-01
Lupus erythematosus 4A40 Whole blood 1.12E-03 4.20E-01 2.77E-01
Major depressive disorder 6A70-6A7Z Hippocampus 2.36E-01 8.43E-02 2.56E-01
Major depressive disorder 6A70-6A7Z Whole blood 3.03E-02 2.55E-01 4.10E-01
Melanoma 2C30 Skin 1.26E-03 -9.28E-01 -6.74E-01
Multiple myeloma 2A83.1 Peripheral blood 4.95E-01 -5.95E-01 -3.52E-01
Multiple myeloma 2A83.1 Bone marrow 5.68E-01 -2.18E-01 -4.10E-01
Multiple sclerosis 8A40 Plasmacytoid dendritic cells 6.91E-03 2.71E-01 1.34E+00
Myelodysplastic syndrome 2A36-2A3Z Bone marrow 7.12E-02 4.11E-01 3.63E-01
Myelofibrosis 2A20.2 Whole blood 1.89E-01 2.44E-01 4.81E-01
Myocardial infarction BA41-BA50 Peripheral blood 2.42E-04 2.81E+00 1.35E+00
Myopathy 8C70.6 Muscle tissue 3.78E-01 8.78E-01 5.71E-01
Neonatal sepsis KA60 Whole blood 1.24E-49 3.21E+00 3.50E+00
Neuroectodermal tumour 2A00.11 Brain stem tissue 4.00E-01 -1.03E+00 -1.01E+00
Non-alcoholic fatty liver disease DB92 Liver tissue 3.28E-01 5.17E-01 9.77E-01
Obesity related type 2 diabetes 5A11 Omental adipose tissue 8.34E-01 -7.21E-02 -2.00E-01
Olive pollen allergy CA08.00 Peripheral blood 2.78E-01 8.63E-02 2.03E-01
Oral cancer 2B6E Oral tissue 1.44E-01 1.32E-01 1.13E-01
Osteoarthritis FA00-FA0Z Synovial tissue 3.36E-01 1.59E-01 8.72E-02
Osteoporosis FB83.1 Bone marrow 7.55E-01 -1.05E-01 -1.91E-01
Ovarian cancer 2C73 Ovarian tissue 5.50E-01 2.90E-01 1.56E-01
Pancreatic cancer 2C10 Pancreas 8.16E-01 7.72E-01 6.03E-01
Parkinson's disease 8A00.0 Substantia nigra tissue 6.25E-01 7.36E-01 6.77E-01
Pediatric respiratory syncytial virus infection CA40.11 Peripheral blood 8.12E-07 1.64E+00 1.74E+00
Pituitary cancer 2D12 Pituitary tissue 1.94E-02 -1.56E+00 -8.77E-01
Pituitary gonadotrope tumour 2D12 Pituitary tissue 8.51E-03 -1.88E+00 -9.53E-01
Polycystic ovary syndrome 5A80.1 Vastus lateralis muscle 3.59E-01 -5.22E-02 -5.69E-01
Polycythemia vera 2A20.4 Whole blood 2.82E-01 3.19E-02 5.87E-02
Pompe disease 5C51.3 Biceps muscle 1.23E-01 4.22E-01 4.33E-01
Preterm birth KA21.4Z Myometrium 1.22E-01 -3.98E-01 -3.72E-01
Prostate cancer 2C82 Prostate 5.37E-06 -1.40E+00 -1.52E+00
Psoriasis EA90 Skin 2.73E-25 -1.22E+00 -1.64E+00
Rectal cancer 2B92 Rectal colon tissue 6.37E-01 -3.59E-01 -6.29E-01
Renal cancer 2C90-2C91 Kidney 9.73E-03 -1.17E+00 -1.30E+00
Retinoblastoma 2D02.2 Uvea 3.45E-03 1.70E+00 8.09E+00
Rheumatoid arthritis FA20 Synovial tissue 3.13E-02 1.08E+00 6.65E-01
Rhinovirus infection CA42.1 Nasal epithelium tissue 7.16E-01 1.17E-01 8.13E-02
Schizophrenia 6A20 Prefrontal cortex 1.02E-01 1.68E-01 1.24E-01
Schizophrenia 6A20 Superior temporal cortex 4.88E-01 2.88E-02 1.08E-01
Scleroderma 4A42.Z Whole blood 2.47E-02 3.80E-01 9.12E-01
Seizure 8A60-8A6Z Whole blood 8.34E-01 4.31E-01 3.87E-01
Sensitive skin EK0Z Skin 8.95E-01 7.85E-02 8.12E-01
Sepsis with septic shock 1G41 Whole blood 4.37E-114 2.94E+00 3.63E+00
Shwachman-Diamond syndrome 3A70.0 Bone marrow 1.70E-01 -1.02E+00 -1.35E+00
Sickle cell disease 3A51.0-3A51.3 Peripheral blood 1.19E-02 -5.69E-01 -7.86E-01
Simpson golabi behmel syndrome LD2C Adipose tissue 2.51E-01 -3.73E-01 -6.89E-01
Sjogren's syndrome 4A43.2 Salivary gland tissue 1.17E-04 6.93E-01 7.65E+00
Skin cancer 2C30-2C3Z Skin 4.73E-42 -1.31E+00 -1.57E+00
Thrombocythemia 3B63 Whole blood 2.35E-03 -4.80E-01 -9.67E-01
Thrombocytopenia 3B64 Whole blood 9.24E-01 -4.76E-02 -1.22E-01
Thyroid cancer 2D10 Thyroid 7.33E-50 3.33E+00 2.97E+00
Tibial muscular dystrophy 8C75 Muscle tissue 2.23E-02 5.29E-01 4.59E-01
Tuberous sclerosis complex LD2D.2 Perituberal tissue 8.46E-01 -6.00E-01 -1.10E+00
Type 2 diabetes 5A11 Liver tissue 1.55E-03 8.10E-01 2.53E+00
Ureter cancer 2C92 Urothelium 6.42E-01 -4.11E-02 -2.19E-01
Uterine cancer 2C78 Endometrium tissue 2.78E-13 -1.51E+00 -1.15E+00
Vitiligo ED63.0 Skin 6.41E-01 1.58E-01 2.37E-01
------------------------------------------------------------------------------------
⏷ Show the Full List of DME Expression Under 107 Diseases

The Drug Therapeutic Target (DTT) Role of This DME

DME DTT Name Cytochrome P450 1B1 (CYP1B1) DTT Info
DME DTT Type Clinical trial
2 Clinical Trial Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
PINOCEMBRIN DM96VWD N. A. N. A. Phase 2 [1]
Naringenin DMHAZLM N. A. N. A. Phase 1 [1]
18 Investigative Drug(s) Targeting This DTT
Drug Name Drug ID Indication ICD 11 Highest Status REF
2-[2-(3,5-Dimethoxy-phenyl)-vinyl]-thiophene DMX1TIU Discovery agent N.A. Investigative [2]
3-[2-(3,5-Dimethoxy-phenyl)-vinyl]-furan DMXE1LC Discovery agent N.A. Investigative [2]
4-[2-(3,5-Dimethoxy-phenyl)-vinyl]-pyridine DM4ENGI Discovery agent N.A. Investigative [2]
Acacetin DMQOB0X Discovery agent N.A. Investigative [1]
Apigenin DMI3491 Discovery agent N.A. Investigative [1]
Chrysin DM7V2LG Discovery agent N.A. Investigative [1]
CHRYSOERIOL DM96ECL Discovery agent N.A. Investigative [1]
DIOSMETIN DM4KXIM Discovery agent N.A. Investigative [1]
ERIODICTYOL DMD3BEQ Discovery agent N.A. Investigative [1]
Galangin DM5TQ2O Discovery agent N.A. Investigative [1]
HOMOERIODICTYOL DM1SDN8 Discovery agent N.A. Investigative [1]
ISORHAMNETIN DMQ4Z6E Discovery agent N.A. Investigative [1]
ISOSAKUTANETIN DMJS7MV Discovery agent N.A. Investigative [1]
KAEMPFERIDE DMUWA2G Discovery agent N.A. Investigative [1]
Kaempferol DMHEMUB Discovery agent N.A. Investigative [1]
N-(2,4-Dimethoxy-phenyl)-3,5-dimethoxy-benzamide DME0YBF Discovery agent N.A. Investigative [2]
TAMARIXETIN DM0EP51 Discovery agent N.A. Investigative [1]
TRISMETHOXYRESVERATROL DM6USPC Discovery agent N.A. Investigative [2]
⏷ Show the Full List of 18 Investigative Drug(s)

References

1 Selective inhibition of methoxyflavonoids on human CYP1B1 activity. Bioorg Med Chem. 2010 Sep 1;18(17):6310-5.
2 Design, synthesis, and discovery of novel trans-stilbene analogues as potent and selective human cytochrome P450 1B1 inhibitors. J Med Chem. 2002 Jan 3;45(1):160-4.
3 Amodiaquine clearance and its metabolism to N-desethylamodiaquine is mediated by CYP2C8: a new high affinity and turnover enzyme-specific probe substrate. J Pharmacol Exp Ther. 2002 Feb;300(2):399-407.
4 Oxidation of xenobiotics by recombinant human cytochrome P450 1B1. Drug Metab Dispos. 1997 May;25(5):617-22.
5 Cytochromes P450 in crustacea. Comp Biochem Physiol C Pharmacol Toxicol Endocrinol. 1998 Nov;121(1-3):157-72.
6 Cytochrome P450 isoforms catalyze formation of catechol estrogen quinones that react with DNA. Metabolism. 2007 Jul;56(7):887-94.
7 A common CYP1B1 polymorphism is associated with 2-OHE1/16-OHE1 urinary estrone ratio. Clin Chem Lab Med. 2005;43(7):702-6.
8 Human CYP1B1 and anticancer agent metabolism: mechanism for tumor-specific drug inactivation? J Pharmacol Exp Ther. 2001 Feb;296(2):537-41.
9 NADPH- and hydroperoxide-supported 17beta-estradiol hydroxylation catalyzed by a variant form (432L, 453S) of human cytochrome P450 1B1. J Steroid Biochem Mol Biol. 2000 Sep;74(1-2):11-8.
10 Metabolism of melatonin by human cytochromes p450. Drug Metab Dispos. 2005 Apr;33(4):489-94.
11 The influence of metabolic gene polymorphisms on urinary 1-hydroxypyrene concentrations in Chinese coke oven workers. Sci Total Environ. 2007 Aug 1;381(1-3):38-46.
12 Tumour cytochrome P450 and drug activation. Curr Pharm Des. 2002;8(15):1335-47.
13 Catalytic properties of polymorphic human cytochrome P450 1B1 variants. Carcinogenesis. 1999 Aug;20(8):1607-13.
14 Pharmacokinetics of rosuvastatin when coadministered with rifampicin in healthy males: a randomized, single-blind, placebo-controlled, crossover study. Clin Ther. 2008 Jul;30(7):1283-9.
15 Metabolism of retinoids and arachidonic acid by human and mouse cytochrome P450 1b1. Drug Metab Dispos. 2004 Aug;32(8):840-7.
16 Cytochrome P450 CYP1B1 interacts with 8-methoxypsoralen (8-MOP) and influences psoralen-ultraviolet A (PUVA) sensitivity. PLoS One. 2013 Sep 23;8(9):e75494.
17 Inhibition of human cytochrome p450 1b1 further clarifies its role in the activation of dibenzo[a,l]pyrene in cells in culture. J Biochem Mol Toxicol. 2007;21(3):101-9.