| DOT Name |
Charged multivesicular body protein 3 (CHMP3)
|
| Synonyms |
Chromatin-modifying protein 3; Neuroendocrine differentiation factor; Vacuolar protein sorting-associated protein 24; hVps24 |
| Gene Name |
CHMP3
|
| Related Disease |
- Advanced cancer ( )
- Breast cancer ( )
- Breast carcinoma ( )
- Herpes simplex infection ( )
- Lung neoplasm ( )
- Polyarteritis nodosa ( )
- Triple negative breast cancer ( )
- Vasculitis due to ADA2 deficiency ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
2GD5 ; 2XZE ; 3FRT ; 3FRV ; 7ZCG ; 7ZCH |
| Pfam ID |
|
| Sequence |
MGLFGKTQEKPPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVC
IVLAKEMIRSRKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKI
PEIQATMRELSKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRILFEITAGALGKA
PSKVTDALPEPEPPGAMAASEDEEEEEEALEAMQSRLATLRS
|
| Function |
Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Selectively binds to phosphatidylinositol 3,5-bisphosphate PtdIns(3,5)P2 and PtdIns(3,4)P2 in preference to other phosphoinositides tested. Involved in late stages of cytokinesis. Plays a role in endosomal sorting/trafficking of EGF receptor. Isoform 2 prevents stress-mediated cell death and accumulation of reactive oxygen species when expressed in yeast cells.
|
| Tissue Specificity |
Widely expressed. Expressed in heart, brain, placenta, lung, liver, skeletal muscle, kidney and pancreas. |
| KEGG Pathway |
- Endocytosis (hsa04144 )
- Necroptosis (hsa04217 )
|
| Reactome Pathway |
- Macroautophagy (R-HSA-1632852 )
- Pyroptosis (R-HSA-5620971 )
- Endosomal Sorting Complex Required For Transport (ESCRT) (R-HSA-917729 )
- HCMV Late Events (R-HSA-9610379 )
- Late endosomal microautophagy (R-HSA-9615710 )
- Sealing of the nuclear envelope (NE) by ESCRT-III (R-HSA-9668328 )
- Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9679504 )
- Translation of Replicase and Assembly of the Replication Transcription Complex (R-HSA-9694676 )
- Budding and maturation of HIV virion (R-HSA-162588 )
|
|
|
|
|
|
|
