Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT0WLH27)

• DOT Name: Protein BEAN1 (BEAN1)
• Synonyms: Brain-expressed protein associating with Nedd4 homolog; BEAN
• Gene Name: BEAN1
• Related Disease:
  Cardiovascular disease
  Dentatorubral-pallidoluysian atrophy
  Hereditary cerebellar ataxia
  Spinocerebellar ataxia type 3
  Spinocerebellar ataxia type 31
  Spinocerebellar ataxia type 6
  Fragile X-associated tremor/ataxia syndrome
  Huntington disease-like 2
  Myotonic dystrophy type 2
  Spinocerebellar ataxia type 10
  Non-insulin dependent diabetes
  Sickle-cell anaemia
  Systemic primary carnitine deficiency disease
• UniProt ID: BEAN1_HUMAN
• Sequence:
  MSFKRPCPLARYNRTSYFYPTFSESSEHSHLLVSPVLVASAVIGVVIILSCITIIVGSIR
  RDRQARLQRHRHRHHRHHHHHHHHRRRRHREYEHGYVSDEHTYSRSSRRMRYACSSSEDW
  PPPLDISSDGDVDATVLRELYPDSPPGYEECVGPGATQLYVPTDAPPPYSLTDSCPTLDG
  TSDSGSGHSPGRHQQEQRTPAQGGLHTVSMDTLPPYEAVCGAGPPSGLLPLPGPDPGPRG
  SQGSPTPTRAPASGPERIV
• KEGG Pathway: Spinocerebellar ataxia (hsa05017)

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[1]
Dentatorubral-pallidoluysian atrophy	DISHWE0K	Strong	Genetic Variation	[2]
Hereditary cerebellar ataxia	DIS17A1W	Strong	Genetic Variation	[2]
Spinocerebellar ataxia type 3	DISQBQID	Strong	Biomarker	[3]
Spinocerebellar ataxia type 31	DISUPR8L	Strong	Autosomal dominant	[4]
Spinocerebellar ataxia type 6	DISH7224	Strong	Genetic Variation	[3]
Fragile X-associated tremor/ataxia syndrome	DISKB25R	moderate	Biomarker	[5]
Huntington disease-like 2	DISM3G09	moderate	Genetic Variation	[5]
Myotonic dystrophy type 2	DIS5ZWF1	moderate	Genetic Variation	[5]
Spinocerebellar ataxia type 10	DISEJVJK	moderate	Genetic Variation	[5]
Non-insulin dependent diabetes	DISK1O5Z	Limited	Biomarker	[6]
Sickle-cell anaemia	DIS5YNZB	Limited	Biomarker	[3]
Systemic primary carnitine deficiency disease	DIS9OPZ4	Limited	Biomarker	[3]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of Protein BEAN1 (BEAN1).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein BEAN1 (BEAN1).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the methylation of Protein BEAN1 (BEAN1).	[12]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein BEAN1 (BEAN1).	[8]
Fluorouracil	DMUM7HZ	Approved	Fluorouracil increases the expression of Protein BEAN1 (BEAN1).	[9]
Isotretinoin	DM4QTBN	Approved	Isotretinoin decreases the expression of Protein BEAN1 (BEAN1).	[10]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein BEAN1 (BEAN1).	[13]

References

• [1] Whole flour and protein hydrolysate from common beans reduce the inflammation in BALB/c mice fed with high fat high cholesterol diet.Food Res Int. 2019 Aug;122:330-339. doi: 10.1016/j.foodres.2019.04.013. Epub 2019 Apr 14.
• [2] SCA31 is rare in the Chinese population on Taiwan.Neurobiol Aging. 2012 Feb;33(2):426.e23-4. doi: 10.1016/j.neurobiolaging.2010.10.012. Epub 2010 Dec 15.
• [3] Impaired Adaptive Motor Learning Is Correlated With Cerebellar Hemispheric Gray Matter Atrophy in Spinocerebellar Ataxia Patients: A Voxel-Based Morphometry Study.Front Neurol. 2019 Nov 14;10:1183. doi: 10.3389/fneur.2019.01183. eCollection 2019.
• [4] Spinocerebellar ataxia type 31 is associated with "inserted" penta-nucleotide repeats containing (TGGAA)n. Am J Hum Genet. 2009 Nov;85(5):544-57. doi: 10.1016/j.ajhg.2009.09.019. Epub 2009 Oct 29.
• [5] CAG repeat RNA as an auxiliary toxic agent in polyglutamine disorders.RNA Biol. 2011 Jul-Aug;8(4):565-71. doi: 10.4161/rna.8.4.15397. Epub 2011 Jul 1.
• [6] -Glucosidase inhibitory activity of protein-rich extracts from extruded adzuki bean in diabetic KK-Ay mice.Food Funct. 2014 May;5(5):966-71. doi: 10.1039/c3fo60521c.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [9] Dissecting progressive stages of 5-fluorouracil resistance in vitro using RNA expression profiling. Int J Cancer. 2004 Nov 1;112(2):200-12. doi: 10.1002/ijc.20401.
• [10] Temporal changes in gene expression in the skin of patients treated with isotretinoin provide insight into its mechanism of action. Dermatoendocrinol. 2009 May;1(3):177-87.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [12] DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
• [13] Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.