Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT1C2HIU)

• DOT Name: Protein-lysine 6-oxidase (LOX)
• Synonyms: EC 1.4.3.13; Lysyl oxidase
• Gene Name: LOX
• Related Disease:
  Aortic aneurysm, familial thoracic 10
  Familial thoracic aortic aneurysm and aortic dissection
• UniProt ID: LYOX_HUMAN
• EC Number: 1.4.3.13
• Pfam ID: PF01186
• Sequence:
  MRFAWTVLLLGPLQLCALVHCAPPAAGQQQPPREPPAAPGAWRQQIQWENNGQVFSLLSL
  GSQYQPQRRRDPGAAVPGAANASAQQPRTPILLIRDNRTAAARTRTAGSSGVTAGRPRPT
  ARHWFQAGYSTSRAREAGASRAENQTAPGEVPALSNLRPPSRVDGMVGDDPYNPYKYSDD
  NPYYNYYDTYERPRPGGRYRPGYGTGYFQYGLPDLVADPYYIQASTYVQKMSMYNLRCAA
  EENCLASTAYRADVRDYDHRVLLRFPQRVKNQGTSDFLPSRPRYSWEWHSCHQHYHSMDE
  FSHYDLLDANTQRRVAEGHKASFCLEDTSCDYGYHRRFACTAHTQGLSPGCYDTYGADID
  CQWIDITDVKPGNYILKVSVNPSYLVPESDYTNNVVRCDIRYTGHHAYASGCTISPY
• Function: Responsible for the post-translational oxidative deamination of peptidyl lysine residues in precursors to fibrous collagen and elastin. Regulator of Ras expression. May play a role in tumor suppression. Plays a role in the aortic wall architecture.
• Tissue Specificity: Heart, placenta, skeletal muscle, kidney, lung and pancreas.
• Reactome Pathway:
  Crosslinking of collagen fibrils (R-HSA-2243919)
  Elastic fibre formation (R-HSA-1566948)

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Aortic aneurysm, familial thoracic 10	DISX2ZNN	Strong	Autosomal dominant	[1]
Familial thoracic aortic aneurysm and aortic dissection	DIS069FB	Strong	Autosomal dominant	[2]

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Chlorothiazide	DMLHESP	Approved	Protein-lysine 6-oxidase (LOX) increases the Metabolic disorder ADR of Chlorothiazide.	[29]

28 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Protein-lysine 6-oxidase (LOX).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Protein-lysine 6-oxidase (LOX).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein-lysine 6-oxidase (LOX).	[5]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Protein-lysine 6-oxidase (LOX).	[6]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Protein-lysine 6-oxidase (LOX).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein-lysine 6-oxidase (LOX).	[4]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Protein-lysine 6-oxidase (LOX).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide increases the expression of Protein-lysine 6-oxidase (LOX).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol increases the expression of Protein-lysine 6-oxidase (LOX).	[11]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Protein-lysine 6-oxidase (LOX).	[12]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Protein-lysine 6-oxidase (LOX).	[13]
Ethanol	DMDRQZU	Approved	Ethanol increases the expression of Protein-lysine 6-oxidase (LOX).	[14]
Cytarabine	DMZD5QR	Approved	Cytarabine decreases the expression of Protein-lysine 6-oxidase (LOX).	[15]
Sulindac	DM2QHZU	Approved	Sulindac decreases the expression of Protein-lysine 6-oxidase (LOX).	[16]
Ampicillin	DMHWE7P	Approved	Ampicillin increases the expression of Protein-lysine 6-oxidase (LOX).	[9]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of Protein-lysine 6-oxidase (LOX).	[17]
Dihydrotestosterone	DM3S8XC	Phase 4	Dihydrotestosterone increases the expression of Protein-lysine 6-oxidase (LOX).	[18]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Protein-lysine 6-oxidase (LOX).	[20]
GSK525762	DMPAWBN	Phase 1	GSK525762 decreases the expression of Protein-lysine 6-oxidase (LOX).	[21]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein-lysine 6-oxidase (LOX).	[22]
Clioquinol	DM746BZ	Withdrawn from market	Clioquinol increases the expression of Protein-lysine 6-oxidase (LOX).	[23]
Beta-aminopropionitrile	DMSJ2I6	Preclinical	Beta-aminopropionitrile decreases the activity of Protein-lysine 6-oxidase (LOX).	[24]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein-lysine 6-oxidase (LOX).	[25]
Nickel chloride	DMI12Y8	Investigative	Nickel chloride increases the expression of Protein-lysine 6-oxidase (LOX).	[26]
OXYQUINOLINE	DMZVS9Y	Investigative	OXYQUINOLINE decreases the expression of Protein-lysine 6-oxidase (LOX).	[9]
I-BET151	DMYRUH2	Investigative	I-BET151 decreases the expression of Protein-lysine 6-oxidase (LOX).	[27]
PFI-1	DMVFK3J	Investigative	PFI-1 decreases the expression of Protein-lysine 6-oxidase (LOX).	[27]
brucine	DM50RUD	Investigative	brucine decreases the expression of Protein-lysine 6-oxidase (LOX).	[28]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic decreases the ubiquitination of Protein-lysine 6-oxidase (LOX).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein-lysine 6-oxidase (LOX).	[19]

References

• [1] The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Phenotypic characterization of retinoic acid differentiated SH-SY5Y cells by transcriptional profiling. PLoS One. 2013 May 28;8(5):e63862.
• [6] Anthracycline inhibits recruitment of hypoxia-inducible transcription factors and suppresses tumor cell migration and cardiac angiogenic response in the host. J Biol Chem. 2012 Oct 12;287(42):34866-34882. doi: 10.1074/jbc.M112.374587. Epub 2012 Aug 20.
• [7] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [8] Quantitative Assessment of Arsenite-Induced Perturbation of Ubiquitinated Proteome. Chem Res Toxicol. 2022 Sep 19;35(9):1589-1597. doi: 10.1021/acs.chemrestox.2c00197. Epub 2022 Aug 22.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Unique signatures of stress-induced senescent human astrocytes. Exp Neurol. 2020 Dec;334:113466. doi: 10.1016/j.expneurol.2020.113466. Epub 2020 Sep 17.
• [11] Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
• [12] Gene induction and apoptosis in human hepatocellular carci-noma cells SMMC-7721 exposed to 5-aza-2'-deoxycytidine. Chin Med J (Engl). 2007 Sep 20;120(18):1626-31.
• [13] Time series analysis of oxidative stress response patterns in HepG2: a toxicogenomics approach. Toxicology. 2013 Apr 5;306:24-34.
• [14] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [15] Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
• [16] NO-sulindac inhibits the hypoxia response of PC-3 prostate cancer cells via the Akt signalling pathway. Int J Cancer. 2009 Jan 1;124(1):223-32. doi: 10.1002/ijc.23934.
• [17] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [18] LSD1 activates a lethal prostate cancer gene network independently of its demethylase function. Proc Natl Acad Sci U S A. 2018 May 1;115(18):E4179-E4188.
• [19] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [20] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [21] The BET inhibitor JQ1 selectively impairs tumour response to hypoxia and downregulates CA9 and angiogenesis in triple negative breast cancer. Oncogene. 2017 Jan 5;36(1):122-132. doi: 10.1038/onc.2016.184. Epub 2016 Jun 13.
• [22] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [23] Clioquinol inhibits dopamine--hydroxylase secretion and noradrenaline synthesis by affecting the redox status of ATOX1 and copper transport in human neuroblastoma SH-SY5Y cells. Arch Toxicol. 2021 Jan;95(1):135-148. doi: 10.1007/s00204-020-02894-0. Epub 2020 Oct 9.
• [24] Abnormal deposition of collagen around hepatocytes in Wilson's disease is associated with hepatocyte specific expression of lysyl oxidase and lysyl oxidase like protein-2. J Hepatol. 2005 Sep;43(3):499-507. doi: 10.1016/j.jhep.2005.02.052.
• [25] Expression and DNA methylation changes in human breast epithelial cells after bisphenol A exposure. Int J Oncol. 2012 Jul;41(1):369-77.
• [26] The contact allergen nickel triggers a unique inflammatory and proangiogenic gene expression pattern via activation of NF-kappaB and hypoxia-inducible factor-1alpha. J Immunol. 2007 Mar 1;178(5):3198-207.
• [27] BRD4 is a novel therapeutic target for liver fibrosis. Proc Natl Acad Sci U S A. 2015 Dec 22;112(51):15713-8. doi: 10.1073/pnas.1522163112. Epub 2015 Dec 7.
• [28] Brucine, an alkaloid from seeds of Strychnos nux-vomica Linn., represses hepatocellular carcinoma cell migration and metastasis: the role of hypoxia inducible factor 1 pathway. Toxicol Lett. 2013 Oct 24;222(2):91-101. doi: 10.1016/j.toxlet.2013.07.024. Epub 2013 Aug 7.
• [29] Genome-wide association analyses suggest NELL1 influences adverse metabolic response to HCTZ in African Americans. Pharmacogenomics J. 2014 Feb;14(1):35-40. doi: 10.1038/tpj.2013.3. Epub 2013 Feb 12.