Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT3DVTRV)

DOT Name Fc receptor-like protein 4 (FCRL4)
Synonyms FcR-like protein 4; FcRL4; Fc receptor homolog 4; FcRH4; IFGP family protein 2; hIFGP2; Immune receptor translocation-associated protein 1; CD antigen CD307d
Gene Name FCRL4
Related Disease
Adult lymphoma ( )
Arthritis ( )
Crohn disease ( )
MALT lymphoma ( )
Pediatric lymphoma ( )
Peeling skin syndrome 1 ( )
Potocki-Shaffer syndrome ( )
Systemic sclerosis ( )
Advanced cancer ( )
Ankylosing spondylitis ( )
Autoimmune disease ( )
B-cell lymphoma ( )
B-cell neoplasm ( )
Chronic graft versus host disease ( )
Hepatitis C virus infection ( )
Lymphoma ( )
Marginal zone lymphoma ( )
Neoplasm ( )
Small lymphocytic lymphoma ( )
Graves disease ( )
Rheumatoid arthritis ( )
UniProt ID
FCRL4_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00047 ; PF13895
Sequence
MLLWASLLAFAPVCGQSAAAHKPVISVHPPWTTFFKGERVTLTCNGFQFYATEKTTWYHR
HYWGEKLTLTPGNTLEVRESGLYRCQARGSPRSNPVRLLFSSDSLILQAPYSVFEGDTLV
LRCHRRRKEKLTAVKYTWNGNILSISNKSWDLLIPQASSNNNGNYRCIGYGDENDVFRSN
FKIIKIQELFPHPELKATDSQPTEGNSVNLSCETQLPPERSDTPLHFNFFRDGEVILSDW
STYPELQLPTVWRENSGSYWCGAETVRGNIHKHSPSLQIHVQRIPVSGVLLETQPSGGQA
VEGEMLVLVCSVAEGTGDTTFSWHREDMQESLGRKTQRSLRAELELPAIRQSHAGGYYCT
ADNSYGPVQSMVLNVTVRETPGNRDGLVAAGATGGLLSALLLAVALLFHCWRRRKSGVGF
LGDETRLPPAPGPGESSHSICPAQVELQSLYVDVHPKKGDLVYSEIQTTQLGEEEEANTS
RTLLEDKDVSVVYSEVKTQHPDNSAGKISSKDEES
Function May function as an inhibitor of the B-cell receptor signaling. May function in the B-cell-mediated immune response.
Tissue Specificity Specifically expressed by memory and monocytoid B-cells which populate spleen and lymph nodes. Preferentially expressed in memory B-cells associated with mucosal tissue (at protein level).

Molecular Interaction Atlas (MIA) of This DOT

21 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult lymphoma DISK8IZR Definitive Altered Expression [1]
Arthritis DIST1YEL Definitive Altered Expression [2]
Crohn disease DIS2C5Q8 Definitive Biomarker [3]
MALT lymphoma DIS1AVVE Definitive Biomarker [4]
Pediatric lymphoma DIS51BK2 Definitive Altered Expression [1]
Peeling skin syndrome 1 DIS35574 Definitive Biomarker [1]
Potocki-Shaffer syndrome DISKGU59 Definitive Biomarker [1]
Systemic sclerosis DISF44L6 Definitive Biomarker [1]
Advanced cancer DISAT1Z9 Strong Altered Expression [5]
Ankylosing spondylitis DISRC6IR Strong Biomarker [6]
Autoimmune disease DISORMTM Strong Biomarker [7]
B-cell lymphoma DISIH1YQ Strong Altered Expression [8]
B-cell neoplasm DISVY326 Strong Biomarker [8]
Chronic graft versus host disease DIS1MM9J Strong Altered Expression [9]
Hepatitis C virus infection DISQ0M8R Strong Biomarker [10]
Lymphoma DISN6V4S Strong Altered Expression [1]
Marginal zone lymphoma DISLZ4AO Strong Biomarker [4]
Neoplasm DISZKGEW Strong Altered Expression [4]
Small lymphocytic lymphoma DIS30POX Strong Biomarker [11]
Graves disease DISU4KOQ moderate Altered Expression [12]
Rheumatoid arthritis DISTSB4J Limited Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 21 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Fc receptor-like protein 4 (FCRL4). [13]
Demecolcine DMCZQGK Approved Demecolcine increases the expression of Fc receptor-like protein 4 (FCRL4). [14]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Fc receptor-like protein 4 (FCRL4). [15]
------------------------------------------------------------------------------------

References

1 FcRL4(+) B-cells in salivary glands of primary Sjgren's syndrome patients.J Autoimmun. 2017 Jul;81:90-98. doi: 10.1016/j.jaut.2017.03.012. Epub 2017 Apr 6.
2 B cells expressing the IgA receptor FcRL4 participate in the autoimmune response in patients with rheumatoid arthritis.J Autoimmun. 2017 Jul;81:34-43. doi: 10.1016/j.jaut.2017.03.004. Epub 2017 Mar 24.
3 Characterization of intestinal gene expression profiles in Crohn's disease by genome-wide microarray analysis.Inflamm Bowel Dis. 2010 Oct;16(10):1717-28. doi: 10.1002/ibd.21263.
4 IRTA1 and MNDA Expression in Marginal Zone Lymphoma: Utility in Differential Diagnosis and Implications for Classification.Am J Clin Pathol. 2019 Feb 4;151(3):337-343. doi: 10.1093/ajcp/aqy144.
5 IRTA1 and IRTA2, novel immunoglobulin superfamily receptors expressed in B cells and involved in chromosome 1q21 abnormalities in B cell malignancy.Immunity. 2001 Mar;14(3):277-89. doi: 10.1016/s1074-7613(01)00109-1.
6 Case-only designs for exploring the interaction between FCRL4 gene and suspected environmental factors in patients with ankylosing spondylitis.Inflammation. 2015 Apr;38(2):632-6. doi: 10.1007/s10753-014-9970-6.
7 Characterization of human FCRL4-positive B cells.PLoS One. 2017 Jun 21;12(6):e0179793. doi: 10.1371/journal.pone.0179793. eCollection 2017.
8 Immunohistochemical analysis of the novel marginal zone B-cell marker IRTA1 in malignant lymphoma.Hum Pathol. 2017 Jan;59:70-79. doi: 10.1016/j.humpath.2016.09.011. Epub 2016 Sep 22.
9 Evidence for B Cell Exhaustion in Chronic Graft-versus-Host Disease.Front Immunol. 2018 Jan 12;8:1937. doi: 10.3389/fimmu.2017.01937. eCollection 2017.
10 Clonal B cells in patients with hepatitis C virus-associated mixed cryoglobulinemia contain an expanded anergic CD21low B-cell subset.Blood. 2011 May 19;117(20):5425-37. doi: 10.1182/blood-2010-10-312942. Epub 2011 Mar 18.
11 Fc receptor-like 1-5 molecules are similarly expressed in progressive and indolent clinical subtypes of B-cell chronic lymphocytic leukemia.Int J Cancer. 2008 Nov 1;123(9):2113-9. doi: 10.1002/ijc.23751.
12 Expression Profile of Human Fc Receptor-Like 1, 2, and 4 Molecules in Peripheral Blood Mononuclear Cells of Patients with Hashimoto's Thyroiditis and Graves' Disease.Horm Metab Res. 2015 Aug;47(9):693-8. doi: 10.1055/s-0035-1545280. Epub 2015 Mar 4.
13 Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
14 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
15 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.