Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4BOECZ)

DOT Name	DnaJ homolog subfamily B member 7 (DNAJB7)
Gene Name	DNAJB7
Related Disease	Prostate cancer ( ) Prostate carcinoma ( ) B-cell neoplasm ( ) Head and neck carcinoma ( ) Leiomyoma ( ) Neoplasm ( ) Squamous cell carcinoma ( ) Uterine fibroids ( ) Head and neck cancer ( ) Head-neck squamous cell carcinoma ( ) Advanced cancer ( ) Oral cancer ( )
UniProt ID	DNJB7_HUMAN
3D Structure	Download 2D Sequence (FASTA) Download 3D Structure (PDB) Download
Pfam ID	PF00226
Sequence	MVDYYEVLGLQRYASPEDIKKAYHKVALKWHPDKNPENKEEAERKFKEVAEAYEVLSNDE KRDIYDKYGTEGLNGGGSHFDDECEYGFTFHKPDDVFKEIFHERDPFSFHFFEDSLEDLL NRPGSSYGNRNRDAGYFFSTASEYPIFEKFSSYDTGYTSQGSLGHEGLTSFSSLAFDNSG MDNYISVTTSDKIVNGRNINTKKIIESDQEREAEDNGELTFFLVNSVANEEGFAKECSWR TQSFNNYSPNSHSSKHVSQYTFVDNDEGGISWVTSNRDPPIFSAGVKEGGKRKKKKRKEV QKKSTKRNC
Function	Probably acts as a co-chaperone.

Molecular Interaction Atlas (MIA) of This DOT

12 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance
Prostate cancer	DISF190Y	Definitive	Biomarker	[1]
Prostate carcinoma	DISMJPLE	Definitive	Biomarker	[1]
B-cell neoplasm	DISVY326	Strong	Altered Expression	[2]
Head and neck carcinoma	DISOU1DS	Strong	Biomarker	[3]
Leiomyoma	DISLDDFN	Strong	Biomarker	[4]
Neoplasm	DISZKGEW	Strong	Biomarker	[5]
Squamous cell carcinoma	DISQVIFL	Strong	Biomarker	[6]
Uterine fibroids	DISBZRMJ	Strong	Biomarker	[4]
Head and neck cancer	DISBPSQZ	moderate	Biomarker	[3]
Head-neck squamous cell carcinoma	DISF7P24	moderate	Biomarker	[7]
Advanced cancer	DISAT1Z9	Limited	Biomarker	[8]
Oral cancer	DISLD42D	Limited	Biomarker	[9]
------------------------------------------------------------------------------------


⏷ Show the Full List of 12 Disease(s)

Molecular Interaction Atlas (MIA)

MIA Detail

Jump to Detail Molecular Interaction Atlas of This DOT

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Amiodarone	DMUTEX3	Phase 2/3 Trial	Amiodarone increases the expression of DnaJ homolog subfamily B member 7 (DNAJB7).	[10]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of DnaJ homolog subfamily B member 7 (DNAJB7).	[11]
------------------------------------------------------------------------------------

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Coumarin	DM0N8ZM	Investigative	Coumarin increases the phosphorylation of DnaJ homolog subfamily B member 7 (DNAJB7).	[12]
------------------------------------------------------------------------------------

References

1	Lapatinib-resistant cancer cells possessing epithelial cancer stem cell properties develop sensitivity during sphere formation by activation of the ErbB/AKT/cyclinD2 pathway.Oncol Rep. 2016 Nov;36(5):3058-3064. doi: 10.3892/or.2016.5073. Epub 2016 Sep 7.
2	Pipoxolan Exhibits Antitumor Activity Toward Oral Squamous Cell Carcinoma Through Reactive Oxygen Species-mediated Apoptosis.Anticancer Res. 2017 Nov;37(11):6391-6400. doi: 10.21873/anticanres.12092.
3	Pseudolaric Acid B Induces Growth Inhibition and Caspase-Dependent Apoptosis on Head and Neck Cancer Cell lines through Death Receptor 5.Molecules. 2019 Oct 16;24(20):3715. doi: 10.3390/molecules24203715.
4	Crosstalk between tongue carcinoma cells, extracellular vesicles, and immune cells in in vitro and in vivo models.Oncotarget. 2017 May 10;8(36):60123-60134. doi: 10.18632/oncotarget.17768. eCollection 2017 Sep 1.
5	DKK3 Overexpression Increases the Malignant Properties of Head and Neck Squamous Cell Carcinoma Cells.Oncol Res. 2018 Jan 19;26(1):45-58. doi: 10.3727/096504017X14926874596386. Epub 2017 May 4.
6	Non-viral suicide gene therapy in cervical, oral and pharyngeal carcinoma cells with CMV- and EEV-plasmids.J Gene Med. 2018 Oct;20(10-11):e3054. doi: 10.1002/jgm.3054. Epub 2018 Oct 3.
7	In vitro humanized 3D microfluidic chip for testing personalized immunotherapeutics for head and neck cancer patients.Exp Cell Res. 2019 Oct 15;383(2):111508. doi: 10.1016/j.yexcr.2019.111508. Epub 2019 Jul 26.
8	DKK3 knockdown confers negative effects on the malignant potency of head and neck squamous cell carcinoma cells via the PI3K/Akt and MAPK signaling pathways.Int J Oncol. 2019 Mar;54(3):1021-1032. doi: 10.3892/ijo.2018.4667. Epub 2018 Dec 14.
9	DNA damage response following X-irradiation in oral cancer cell lines HSC3 and HSC4.Arch Oral Biol. 2018 Jun;90:1-8. doi: 10.1016/j.archoralbio.2018.02.016. Epub 2018 Mar 6.
10	Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
11	Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
12	Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.