Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4DJHCM)

• DOT Name: Protein FAM171B (FAM171B)
• Gene Name: FAM171B
• Related Disease:
  Colorectal carcinoma
  Crohn disease
  Inflammatory bowel disease
• UniProt ID: F171B_HUMAN
• Pfam ID: PF20771 ; PF10577
• Sequence:
  MARLCRRVPCTLLLGLAVVLLKARLVPAAARAELSRSDLSLIQQQQQQQQQQQQQQKQLE
  EAEEERTEVPGATSTLTVPVSVFMLKVQVNDIISRQYLSQAVVEVFVNYTKTNSTVTKSN
  GAVLIKVPYKLGLSLTIIAYKDGYVLTPLPWKTRRMPIYSSVTLSLFPQSQANIWLFEDT
  VLITGKLADAKSQPSVQFSKALIKLPDNHHISNVTGYLTVLQQFLKVDNFLHTTGITLNK
  PGFENIELTPLAAICVKIYSGGKELKVNGSIQVSLPLLRLNDISAGDRIPAWTFDMNTGA
  WVNHGRGMVKEHNNHLIWTYDAPHLGYWIAAPLPGTRGSGINEDSKDITAYHTVFLTAIL
  GGTIVIVIGFFAVLLCYCRDKCGTPQKRERNITKLEVLKRDQTTSTTHINHISTVKVALK
  AEDKSQLFNAKNSSYSPQKKEPSKAETEERVSMVKTRDDFKIYNEDVSFLSVNQNNYSRN
  PTQSLEPNVGSKQPKHINNNLSSSLGDAQDEKRYLTGNEEAYGRSHIPEQLMHIYSQPIA
  ILQTSDLFSTPEQLHTAKSATLPRKGQLVYGQLMEPVNRENFTQTLPKMPIHSHAQPPDA
  REEDIILEGQQSLPSQASDWSRYSSSLLESVSVPGTLNEAVVMTPFSSELQGISEQTLLE
  LSKGKPSPHPRAWFVSLDGKPVAQVRHSFIDLKKGKRTQSNDTSLDSGVDMNELHSSRKL
  EREKTFIKSMHQPKILYLEDLDLSSSESGTTVCSPEDPALRHILDGGSGVIMEHPGEESP
  GRKSTVEDFEANTSPTKRRGRPPLAKRDSKTNIWKKREERPLIPIN

Molecular Interaction Atlas (MIA) of This DOT

3 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[1]
Crohn disease	DIS2C5Q8	Limited	Genetic Variation	[2]
Inflammatory bowel disease	DISGN23E	Limited	Genetic Variation	[2]

13 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Protein FAM171B (FAM171B).	[3]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Protein FAM171B (FAM171B).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Protein FAM171B (FAM171B).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Protein FAM171B (FAM171B).	[6]
Zoledronate	DMIXC7G	Approved	Zoledronate decreases the expression of Protein FAM171B (FAM171B).	[8]
Liothyronine	DM6IR3P	Approved	Liothyronine decreases the expression of Protein FAM171B (FAM171B).	[9]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Protein FAM171B (FAM171B).	[10]
OTX-015	DMI8RG1	Phase 1/2	OTX-015 increases the expression of Protein FAM171B (FAM171B).	[11]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 increases the expression of Protein FAM171B (FAM171B).	[13]
Mivebresib	DMCPF90	Phase 1	Mivebresib increases the expression of Protein FAM171B (FAM171B).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Protein FAM171B (FAM171B).	[14]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of Protein FAM171B (FAM171B).	[15]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Protein FAM171B (FAM171B).	[16]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Protein FAM171B (FAM171B).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of Protein FAM171B (FAM171B).	[12]

References

• [1] MiR-483-3p regulates oxaliplatin resistance by targeting FAM171B in human colorectal cancer cells.Artif Cells Nanomed Biotechnol. 2019 Dec;47(1):725-736. doi: 10.1080/21691401.2019.1569530.
• [2] Genome-wide association study implicates immune activation of multiple integrin genes in inflammatory bowel disease.Nat Genet. 2017 Feb;49(2):256-261. doi: 10.1038/ng.3760. Epub 2017 Jan 9.
• [3] The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
• [4] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [5] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [8] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [9] Monitoring of deiodinase deficiency based on transcriptomic responses in SH-SY5Y cells. Arch Toxicol. 2013 Jun;87(6):1103-13. doi: 10.1007/s00204-013-1018-4. Epub 2013 Feb 10.
• [10] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [11] Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
• [12] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [13] Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
• [14] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [15] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [16] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.