Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4FRKXR)

DOT Name Protein mab-21-like 4 (MAB21L4)
Gene Name MAB21L4
Related Disease
Major depressive disorder ( )
UniProt ID
MB214_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF20266
Sequence
MPAPALPTSAMAVQVPLWHHYLQAIRSREAPRAQDFQRAENVLLTVLERVHALDPRFIVD
YSRGLEAFQFALRSSEDPMDMEVPLWVDAEALLIEEPEATQPEDGLELCHLGVPREGAGL
ERWTTEDTFTASSEGDAKCRGHIVPSKVLCVLKDLLVAAIVHCKHHSLIAPGSLNAASLR
EEQLHLSLLVSSGWRTISFHVVPVVRRKLGAPALEGVQQMPGFPEGSLRRILSQGVDLVP
ASAQLWRTSTDYLLTRLLGELGSLQGHRLDSLSILDRVNHESWRDSGQTDGLTFGHLKMV
LLWASVLFLAPEDWAELQGAVYRLLVVLLCCLATRKLPHFLHPQRNLLQGSGLDLGAIYQ
RVEGFASQPEAALRIHATHLGRSPPPRIGSGLKALLQLPASDPTYWATAYFDVLLDKFQV
FNIQDKDRISAMQSIFQKTRTLGGEES

Molecular Interaction Atlas (MIA) of This DOT

1 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Major depressive disorder DIS4CL3X Strong Genetic Variation [1]
------------------------------------------------------------------------------------
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Protein mab-21-like 4 (MAB21L4). [2]
------------------------------------------------------------------------------------
12 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Protein mab-21-like 4 (MAB21L4). [3]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of Protein mab-21-like 4 (MAB21L4). [4]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of Protein mab-21-like 4 (MAB21L4). [5]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of Protein mab-21-like 4 (MAB21L4). [6]
Menadione DMSJDTY Approved Menadione affects the expression of Protein mab-21-like 4 (MAB21L4). [7]
Genistein DM0JETC Phase 2/3 Genistein increases the expression of Protein mab-21-like 4 (MAB21L4). [8]
OTX-015 DMI8RG1 Phase 1/2 OTX-015 decreases the expression of Protein mab-21-like 4 (MAB21L4). [9]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Protein mab-21-like 4 (MAB21L4). [10]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Protein mab-21-like 4 (MAB21L4). [11]
Mivebresib DMCPF90 Phase 1 Mivebresib decreases the expression of Protein mab-21-like 4 (MAB21L4). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Protein mab-21-like 4 (MAB21L4). [12]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Protein mab-21-like 4 (MAB21L4). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 12 Drug(s)

References

1 The PHF21B gene is associated with major depression and modulates the stress response.Mol Psychiatry. 2017 Jul;22(7):1015-1025. doi: 10.1038/mp.2016.174. Epub 2016 Oct 25.
2 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
3 Effect of retinoic acid on gene expression in human conjunctival epithelium: secretory phospholipase A2 mediates retinoic acid induction of MUC16. Invest Ophthalmol Vis Sci. 2005 Nov;46(11):4050-61.
4 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
5 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
6 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
7 Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
8 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
9 Comprehensive transcriptome profiling of BET inhibitor-treated HepG2 cells. PLoS One. 2022 Apr 29;17(4):e0266966. doi: 10.1371/journal.pone.0266966. eCollection 2022.
10 Inter- and intra-laboratory study to determine the reproducibility of toxicogenomics datasets. Toxicology. 2011 Nov 28;290(1):50-8.
11 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
12 Bisphenolic compounds alter gene expression in MCF-7 cells through interaction with estrogen receptor . Toxicol Appl Pharmacol. 2020 Jul 15;399:115030. doi: 10.1016/j.taap.2020.115030. Epub 2020 May 6.
13 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.