Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT4IAAZP)

• DOT Name: Thiol S-methyltransferase TMT1A (TMT1A)
• Synonyms: EC 2.1.1.9; Methyltransferase-like protein 7A; N6-adenosine-methyltransferase TMT1A; EC 2.1.1.348; Protein AAM-B; Thiol methyltransferase 1A
• Gene Name: TMT1A
• UniProt ID: TMT1A_HUMAN
• EC Number: 2.1.1.348; 2.1.1.9
• Pfam ID: PF08241
• Sequence:
  MELTIFILRLAIYILTFPLYLLNFLGLWSWICKKWFPYFLVRFTVIYNEQMASKKRELFS
  NLQEFAGPSGKLSLLEVGCGTGANFKFYPPGCRVTCIDPNPNFEKFLIKSIAENRHLQFE
  RFVVAAGENMHQVADGSVDVVVCTLVLCSVKNQERILREVCRVLRPGGAFYFMEHVAAEC
  STWNYFWQQVLDPAWHLLFDGCNLTRESWKALERASFSKLKLQHIQAPLSWELVRPHIYG
  YAVK
• Function: Thiol S-methyltransferase that catalyzes the transfer of a methyl group from S-adenosyl-L-methionine to alkyl and phenolic thiol-containing acceptor substrates. Together with TMT1B accounts for most of S-thiol methylation activity in the endoplasmic reticulum of hepatocytes. Able to methylate the N6 position of adenosine residues in long non-coding RNAs (lncRNAs). May facilitate lncRNAs transfer into exosomes at the tumor-stroma interface. Promotes osteogenic and odontogenic differentiation by regulating the expression of genes involved in stem cell differentiation and survival. Targeted from the endoplasmic reticulum to lipid droplets, where it recruits cellular proteins to form functional organelles ; (Microbial infection) May be involved in the assembly and release stages of hepatitis C virus (HCV) life cycle and thus play a crucial role in HCV propagation.
• Tissue Specificity: Expressed in the liver.
• Reactome Pathway: Neutrophil degranulation (R-HSA-6798695)

Molecular Interaction Atlas (MIA) of This DOT

This DOT Affected the Drug Response of 1 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Arsenic	DMTL2Y1	Approved	Thiol S-methyltransferase TMT1A (TMT1A) increases the response to substance of Arsenic.	[31]

31 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[1]
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[7]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[8]
Quercetin	DM3NC4M	Approved	Quercetin decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[9]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[10]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[11]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[11]
Triclosan	DMZUR4N	Approved	Triclosan increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[12]
Decitabine	DMQL8XJ	Approved	Decitabine increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[13]
Progesterone	DMUY35B	Approved	Progesterone increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[14]
Dexamethasone	DMMWZET	Approved	Dexamethasone increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[15]
Hydroquinone	DM6AVR4	Approved	Hydroquinone decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[16]
Azathioprine	DMMZSXQ	Approved	Azathioprine decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[17]
Ethanol	DMDRQZU	Approved	Ethanol decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[18]
Resveratrol	DM3RWXL	Phase 3	Resveratrol increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[19]
Genistein	DM0JETC	Phase 2/3	Genistein decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[8]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[21]
Leflunomide	DMR8ONJ	Phase 1 Trial	Leflunomide decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[22]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[23]
MG-132	DMKA2YS	Preclinical	MG-132 decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[24]
UNC0379	DMD1E4J	Preclinical	UNC0379 increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[25]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A affects the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[26]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[27]
Formaldehyde	DM7Q6M0	Investigative	Formaldehyde increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[28]
Coumestrol	DM40TBU	Investigative	Coumestrol increases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[29]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane decreases the expression of Thiol S-methyltransferase TMT1A (TMT1A).	[30]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Thiol S-methyltransferase TMT1A (TMT1A).	[20]

References

• [1] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [4] Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Activation of AIFM2 enhances apoptosis of human lung cancer cells undergoing toxicological stress. Toxicol Lett. 2016 Sep 6;258:227-236.
• [8] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [9] Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
• [10] Oxidative stress modulates theophylline effects on steroid responsiveness. Biochem Biophys Res Commun. 2008 Dec 19;377(3):797-802.
• [11] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [12] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [13] The DNA methyltransferase inhibitors azacitidine, decitabine and zebularine exert differential effects on cancer gene expression in acute myeloid leukemia cells. Leukemia. 2009 Jun;23(6):1019-28.
• [14] Coordinate up-regulation of TMEM97 and cholesterol biosynthesis genes in normal ovarian surface epithelial cells treated with progesterone: implications for pathogenesis of ovarian cancer. BMC Cancer. 2007 Dec 11;7:223.
• [15] Gene expression profile of human lymphoid CEM cells sensitive and resistant to glucocorticoid-evoked apoptosis. Genomics. 2003 Jun;81(6):543-55.
• [16] Keratinocyte-derived IL-36gama plays a role in hydroquinone-induced chemical leukoderma through inhibition of melanogenesis in human epidermal melanocytes. Arch Toxicol. 2019 Aug;93(8):2307-2320.
• [17] A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
• [18] Chronic ethanol exposure increases goosecoid (GSC) expression in human embryonic carcinoma cell differentiation. J Appl Toxicol. 2014 Jan;34(1):66-75.
• [19] A novel long noncoding RNA AK001796 acts as an oncogene and is involved in cell growth inhibition by resveratrol in lung cancer. Toxicol Appl Pharmacol. 2015 Jun 1;285(2):79-88.
• [20] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [21] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [22] Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
• [23] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [24] Proteasome inhibition creates a chromatin landscape favorable to RNA Pol II processivity. J Biol Chem. 2020 Jan 31;295(5):1271-1287. doi: 10.1074/jbc.RA119.011174. Epub 2019 Dec 5.
• [25] Epigenetic siRNA and chemical screens identify SETD8 inhibition as a therapeutic strategy for p53 activation in high-risk neuroblastoma. Cancer Cell. 2017 Jan 9;31(1):50-63.
• [26] Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.
• [27] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [28] Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
• [29] Pleiotropic combinatorial transcriptomes of human breast cancer cells exposed to mixtures of dietary phytoestrogens. Food Chem Toxicol. 2009 Apr;47(4):787-95.
• [30] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.
• [31] Gene expression levels in normal human lymphoblasts with variable sensitivities to arsenite: identification of GGT1 and NFKBIE expression levels as possible biomarkers of susceptibility. Toxicol Appl Pharmacol. 2008 Jan 15;226(2):199-205. doi: 10.1016/j.taap.2007.09.004. Epub 2007 Sep 15.