Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT5K4UFL)

• DOT Name: Protein STPG4 (STPG4)
• Synonyms: Gonad-specific expression gene protein; GSE; Sperm-tail PG-rich repeat-containing protein 4
• Gene Name: STPG4
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Chronic obstructive pulmonary disease
  Coeliac disease
  Depression
  Glioma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Lung squamous cell carcinoma
  Metastatic melanoma
  Multiple intestinal atresia
  Non-small-cell lung cancer
  Ventricular septal defect
  Hepatocellular carcinoma
  Nasopharyngeal carcinoma
  Niemann-Pick disease type C
  Adult glioblastoma
  Glioblastoma multiforme
  Patent ductus arteriosus
  Squamous cell carcinoma
  Stroke
  Type-1 diabetes
• UniProt ID: STPG4_HUMAN
• Pfam ID: PF07004
• Sequence:
  MDQPAVATASTSIREDLVGGESFITASKPAQKTSSFEREGWWRIALTDTPIPGTYHLKTF
  IEESLLNPVIATYNFKNEGRKKPPLVQRNNPVLNDLPQYMPPDFLDLLKKQVATYSFKDK
  PRPSPSTLVDKDQSLQLSPGQYNVLPAPVPKYASRSCVFRSTVQRFPTTYFIPHEGPGPG
  HYNVKMPPTSSVTSCFQSRVPRFLPSCSKTPGPGAYTTLRQFPKQSPTIAKMGQEHSLFF
  NNNNWLLK
• Function: Maternal factor that plays a role in epigenetic chromatin reprogramming during early development of the zygote. Involved in the regulation of gametic DNA demethylation by inducing the conversion of the modified genomic base 5-methylcytosine (5mC) into 5-hydroxymethylcytosine (5hmC).
• Reactome Pathway: Chromatin modifications during the maternal to zygotic transition (MZT) (R-HSA-9821002)

Molecular Interaction Atlas (MIA) of This DOT

24 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Biomarker	[1]
Breast cancer	DIS7DPX1	Strong	Genetic Variation	[2]
Breast carcinoma	DIS2UE88	Strong	Genetic Variation	[2]
Chronic obstructive pulmonary disease	DISQCIRF	Strong	Altered Expression	[3]
Coeliac disease	DISIY60C	Strong	Genetic Variation	[4]
Depression	DIS3XJ69	Strong	Altered Expression	[5]
Glioma	DIS5RPEH	Strong	Genetic Variation	[6]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[1]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[7]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[7]
Lung squamous cell carcinoma	DISXPIBD	Strong	Biomarker	[8]
Metastatic melanoma	DISSL43L	Strong	Altered Expression	[1]
Multiple intestinal atresia	DISNUH76	Strong	CausalMutation	[9]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[3]
Ventricular septal defect	DISICO41	Strong	CausalMutation	[9]
Hepatocellular carcinoma	DIS0J828	moderate	Biomarker	[10]
Nasopharyngeal carcinoma	DISAOTQ0	moderate	Altered Expression	[11]
Niemann-Pick disease type C	DIS492ZO	moderate	Altered Expression	[11]
Adult glioblastoma	DISVP4LU	Disputed	Altered Expression	[12]
Glioblastoma multiforme	DISK8246	Disputed	Altered Expression	[12]
Patent ductus arteriosus	DIS9P8YS	Limited	Biomarker	[13]
Squamous cell carcinoma	DISQVIFL	Limited	Altered Expression	[14]
Stroke	DISX6UHX	Limited	Biomarker	[15]
Type-1 diabetes	DIS7HLUB	Limited	Altered Expression	[16]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Trichostatin A	DM9C8NX	Investigative	Trichostatin A affects the expression of Protein STPG4 (STPG4).	[17]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Octanal	DMTN0OK	Investigative	Octanal increases the methylation of Protein STPG4 (STPG4).	[18]

References

• [1] Inhibition of glutamate oxaloacetate transaminase 1 in cancer cell lines results in altered metabolism with increased dependency of glucose.BMC Cancer. 2018 May 11;18(1):559. doi: 10.1186/s12885-018-4443-1.
• [2] Identification of differently expressed genes with specific SNP Loci for breast cancer by the integration of SNP and gene expression profiling analyses.Pathol Oncol Res. 2015 Apr;21(2):469-75. doi: 10.1007/s12253-014-9851-1. Epub 2014 Nov 19.
• [3] Myocyte enhancer factor 2D provides a cross-talk between chronic inflammation and lung cancer.J Transl Med. 2017 Mar 24;15(1):65. doi: 10.1186/s12967-017-1168-x.
• [4] Two locus models for gluten sensitive enteropathy: population genetic considerations.Am J Med Genet. 1981;8(2):205-14. doi: 10.1002/ajmg.1320080211.
• [5] A Comparison of Stress Perception in International and Local First Semester Medical Students Using Psychometric, Psychophysiological, and Humoral Methods.Int J Environ Res Public Health. 2018 Dec 11;15(12):2820. doi: 10.3390/ijerph15122820.
• [6] Galectin-9: A Predictive Biomarker Negatively Regulating Immune Response in Glioma Patients.World Neurosurg. 2019 Dec;132:e455-e462. doi: 10.1016/j.wneu.2019.08.117. Epub 2019 Aug 27.
• [7] A four-gene signature from NCI-60 cell line for survival prediction in non-small cell lung cancer.Clin Cancer Res. 2009 Dec 1;15(23):7309-15. doi: 10.1158/1078-0432.CCR-09-1572. Epub 2009 Nov 17.
• [8] The clinical and prognostic value of polo-like kinase 1 in lung squamous cell carcinoma patients: immunohistochemical analysis.Biosci Rep. 2017 Aug 31;37(4):BSR20170852. doi: 10.1042/BSR20170852. Epub 2017 Jul 19.
• [9] A prospective evaluation of whole-exome sequencing as a first-tier molecular test in infants with suspected monogenic disorders.Genet Med. 2016 Nov;18(11):1090-1096. doi: 10.1038/gim.2016.1. Epub 2016 Mar 3.
• [10] Up-Regulation of hsa_circ_0000517 Predicts Adverse Prognosis of Hepatocellular Carcinoma.Front Oncol. 2019 Oct 22;9:1105. doi: 10.3389/fonc.2019.01105. eCollection 2019.
• [11] Downregulation of FoxM1 sensitizes nasopharyngeal carcinoma cells to cisplatin via inhibition of MRN-ATM-mediated DNA repair.BMB Rep. 2019 Mar;52(3):208-213. doi: 10.5483/BMBRep.2019.52.3.249.
• [12] Identification of Potential Biomarkers in Glioblastoma through Bioinformatic Analysis and Evaluating Their Prognostic Value.Biomed Res Int. 2019 Apr 15;2019:6581576. doi: 10.1155/2019/6581576. eCollection 2019.
• [13] Transcriptional profiles in the chicken ductus arteriosus during hatching.PLoS One. 2019 Mar 21;14(3):e0214139. doi: 10.1371/journal.pone.0214139. eCollection 2019.
• [14] Matrix metalloproteinase 1: a better biomarker for squamous cell carcinoma by multiple microarray analyses.G Ital Dermatol Venereol. 2019 Jun;154(3):327-337. doi: 10.23736/S0392-0488.17.05770-4. Epub 2017 Dec 15.
• [15] Neuroprotective effect of grape seed extract on brain ischemia: a proteomic approach.Metab Brain Dis. 2019 Jun;34(3):889-907. doi: 10.1007/s11011-019-00396-2. Epub 2019 Feb 22.
• [16] Microarray based analysis of gene regulation by microRNA in intervertebral disc degeneration.Mol Med Rep. 2015 Oct;12(4):4925-30. doi: 10.3892/mmr.2015.4022. Epub 2015 Jul 2.
• [17] A trichostatin A expression signature identified by TempO-Seq targeted whole transcriptome profiling. PLoS One. 2017 May 25;12(5):e0178302. doi: 10.1371/journal.pone.0178302. eCollection 2017.
• [18] DNA Methylome Analysis of Saturated Aliphatic Aldehydes in Pulmonary Toxicity. Sci Rep. 2018 Jul 12;8(1):10497. doi: 10.1038/s41598-018-28813-z.