Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT65U8L1)

DOT Name Putative glycerol kinase 5 (GK5)
Synonyms GK 5; Glycerokinase 5; EC 2.7.1.30; ATP:glycerol 3-phosphotransferase 5
Gene Name GK5
Related Disease
Essential tremor ( )
Multiple sclerosis ( )
Parkinson disease ( )
Adenocarcinoma ( )
Adult glioblastoma ( )
Glioblastoma multiforme ( )
Lung adenocarcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Non-small-cell lung cancer ( )
UniProt ID
GLPK5_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
2.7.1.30
Pfam ID
PF02782 ; PF00370
Sequence
MSGLLTDPEQRAQEPRYPGFVLGLDVGSSVIRCHVYDRAARVCGSSVQKVENLYPQIGWV
EIDPDVLWIQFVAVIKEAVKAAGIQMNQIVGLGISTQRATFITWNKKTGNHFHNFISWQD
LRAVELVKSWNNSLLMKIFHSSCRVLHFFTRSKRLFTASLFTFTTQQTSLRLVWILQNLT
EVQKAVEEENCCFGTIDTWLLYKLTKGSVYATDFSNASTTGLFDPYKMCWSGMITSLISI
PLSLLPPVRDTSHNFGSVDEEIFGVPIPIVALVADQQSAMFGECCFQTGDVKLTMGTGTF
LDINTGNSLQQTTGGFYPLIGWKIGQEVVCLAESNAGDTGTAIKWAQQLDLFTDAAETEK
MAKSLEDSEGVCFVPSFSGLQAPLNDPWACASFMGLKPSTSKYHLVRAILESIAFRNKQL
YEMMKKEIHIPVRKIRADGGVCKNGFVMQMTSDLINENIDRPADIDMSCLGAASLAGLAV
GFWTDKEELKKLRQSEVVFKPQKKCQEYEMSLENWAKAVKRSMNWYNKT

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Essential tremor DIS7GBKQ Definitive Biomarker [1]
Multiple sclerosis DISB2WZI Definitive Biomarker [1]
Parkinson disease DISQVHKL Definitive Biomarker [1]
Adenocarcinoma DIS3IHTY Strong Biomarker [2]
Adult glioblastoma DISVP4LU Strong Altered Expression [3]
Glioblastoma multiforme DISK8246 Strong Altered Expression [3]
Lung adenocarcinoma DISD51WR Strong Altered Expression [2]
Lung cancer DISCM4YA Strong Biomarker [2]
Lung carcinoma DISTR26C Strong Biomarker [2]
Non-small-cell lung cancer DIS5Y6R9 Strong Biomarker [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
9 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Putative glycerol kinase 5 (GK5). [4]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Putative glycerol kinase 5 (GK5). [5]
Cisplatin DMRHGI9 Approved Cisplatin decreases the expression of Putative glycerol kinase 5 (GK5). [6]
Calcitriol DM8ZVJ7 Approved Calcitriol increases the expression of Putative glycerol kinase 5 (GK5). [7]
Testosterone DM7HUNW Approved Testosterone increases the expression of Putative glycerol kinase 5 (GK5). [8]
Amiodarone DMUTEX3 Phase 2/3 Trial Amiodarone increases the expression of Putative glycerol kinase 5 (GK5). [9]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Putative glycerol kinase 5 (GK5). [11]
Trichostatin A DM9C8NX Investigative Trichostatin A decreases the expression of Putative glycerol kinase 5 (GK5). [12]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Putative glycerol kinase 5 (GK5). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Putative glycerol kinase 5 (GK5). [10]
------------------------------------------------------------------------------------

References

1 Functional lesional neurosurgery for tremor: a systematic review and meta-analysis.J Neurol Neurosurg Psychiatry. 2018 Jul;89(7):717-726. doi: 10.1136/jnnp-2017-316302. Epub 2018 Jan 11.
2 Glycerol kinase 5 confers gefitinib resistance through SREBP1/SCD1 signaling pathway.J Exp Clin Cancer Res. 2019 Feb 21;38(1):96. doi: 10.1186/s13046-019-1057-7.
3 MicroRNA-135b exerts oncogenic activity in glioblastoma via the inhibition of glycerol kinase 5 expression.Mol Med Rep. 2015 Aug;12(2):2721-6. doi: 10.3892/mmr.2015.3708. Epub 2015 Apr 30.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
6 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
7 Large-scale in silico and microarray-based identification of direct 1,25-dihydroxyvitamin D3 target genes. Mol Endocrinol. 2005 Nov;19(11):2685-95.
8 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
9 Identification by automated screening of a small molecule that selectively eliminates neural stem cells derived from hESCs but not dopamine neurons. PLoS One. 2009 Sep 23;4(9):e7155.
10 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
11 Bisphenol A and bisphenol S induce distinct transcriptional profiles in differentiating human primary preadipocytes. PLoS One. 2016 Sep 29;11(9):e0163318.
12 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
13 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.