Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT67PERT)

• DOT Name: Prostate and breast cancer overexpressed gene 1 protein (PBOV1)
• Synonyms: Protein UROC28; UC28
• Gene Name: PBOV1
• Related Disease:
  Rheumatoid arthritis
  Bladder cancer
  Breast cancer
  Breast carcinoma
  Epithelial ovarian cancer
  Hepatocellular carcinoma
  Ovarian cancer
  Ovarian neoplasm
  Prostate cancer
  Urinary bladder cancer
  Urinary bladder neoplasm
  Advanced cancer
  Prostate carcinoma
  Glioma
  Metastatic malignant neoplasm
  Neoplasm
• UniProt ID: PBOV1_HUMAN
• Sequence:
  MRAFLRNQKYEDMHNIIHILQIRKLRHRLSNFPRLPGILAPETVLLPFCYKVFRKKEKVK
  RSQKATEFIDYSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFTLTLQLTQTLGLE
  CCLLYLSKTIHPQII
• Tissue Specificity: Expressed in colon, prostate, small intestine, testis and spleen, with lower expression in thymus, ovary, and peripheral blood leukocytes. Up-regulated expression in prostate, breast, and bladder cancer, but not in lung and colon cancer.

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Rheumatoid arthritis	DISTSB4J	Definitive	Biomarker	[1]
Bladder cancer	DISUHNM0	Strong	Altered Expression	[2]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[3]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[3]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[2]
Hepatocellular carcinoma	DIS0J828	Strong	Altered Expression	[4]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[2]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[2]
Prostate cancer	DISF190Y	Strong	Altered Expression	[5]
Urinary bladder cancer	DISDV4T7	Strong	Altered Expression	[2]
Urinary bladder neoplasm	DIS7HACE	Strong	Altered Expression	[2]
Advanced cancer	DISAT1Z9	moderate	Biomarker	[5]
Prostate carcinoma	DISMJPLE	moderate	Altered Expression	[5]
Glioma	DIS5RPEH	Limited	Altered Expression	[3]
Metastatic malignant neoplasm	DIS86UK6	Limited	Altered Expression	[4]
Neoplasm	DISZKGEW	Limited	Altered Expression	[5]

1 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Prostate and breast cancer overexpressed gene 1 protein (PBOV1).	[6]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Prostate and breast cancer overexpressed gene 1 protein (PBOV1).	[7]

References

• [1] lncRNA NTT/PBOV1 Axis Promotes Monocyte Differentiation and Is Elevated in Rheumatoid Arthritis.Int J Mol Sci. 2018 Sep 18;19(9):2806. doi: 10.3390/ijms19092806.
• [2] PBOV1 correlates with progression of ovarian cancer and inhibits proliferation of ovarian cancer cells.Oncol Rep. 2016 Jan;35(1):488-96. doi: 10.3892/or.2015.4396. Epub 2015 Nov 4.
• [3] PBOV1 is a human de novo gene with tumor-specific expression that is associated with a positive clinical outcome of cancer.PLoS One. 2013;8(2):e56162. doi: 10.1371/journal.pone.0056162. Epub 2013 Feb 13.
• [4] Association between the overexpression of PBOV1 and the prognosis of patients with hepatocellular carcinoma.Oncol Lett. 2018 Sep;16(3):3401-3407. doi: 10.3892/ol.2018.9013. Epub 2018 Jun 25.
• [5] PBOV1 as a potential biomarker for more advanced prostate cancer based on protein and digital histomorphometric analysis.Prostate. 2018 May;78(7):547-559. doi: 10.1002/pros.23499. Epub 2018 Mar 9.
• [6] 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
• [7] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.