Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT68YFO1)

DOT Name PDZ domain-containing protein GIPC2 (GIPC2)
Gene Name GIPC2
Related Disease
Breast cancer ( )
Breast carcinoma ( )
Colorectal neoplasm ( )
Gastric cancer ( )
Kidney neoplasm ( )
Neoplasm ( )
Schizophrenia ( )
Stomach cancer ( )
Acute lymphocytic leukaemia ( )
Melanoma ( )
Ovarian cancer ( )
Lung adenocarcinoma ( )
Lung carcinoma ( )
Psoriasis ( )
UniProt ID
GIPC2_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3GGE
Pfam ID
PF00595
Sequence
MPLKLRGKKKAKSKETAGLVEGEPTGAGGGSLSASRAPARRLVFHAQLAHGSATGRVEGF
SSIQELYAQIAGAFEISPSEILYCTLNTPKIDMERLLGGQLGLEDFIFAHVKGIEKEVNV
YKSEDSLGLTITDNGVGYAFIKRIKDGGVIDSVKTICVGDHIESINGENIVGWRHYDVAK
KLKELKKEELFTMKLIEPKKAFEIELRSKAGKSSGEKIGCGRATLRLRSKGPATVEEMPS
ETKAKAIEKIDDVLELYMGIRDIDLATTMFEAGKDKVNPDEFAVALDETLGDFAFPDEFV
FDVWGVIGDAKRRGL
Tissue Specificity
Expressed at highest levels in ascending colon and at moderate levels in adult kidney. Expressed at low levels in adult pancreas and at very low levels in adult liver. Expression is down-regulated in several primary tumors, such as kidney, colon and rectal tumors.

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Breast cancer DIS7DPX1 Strong Altered Expression [1]
Breast carcinoma DIS2UE88 Strong Altered Expression [1]
Colorectal neoplasm DISR1UCN Strong Altered Expression [2]
Gastric cancer DISXGOUK Strong Altered Expression [1]
Kidney neoplasm DISBNZTN Strong Altered Expression [2]
Neoplasm DISZKGEW Strong Altered Expression [2]
Schizophrenia DISSRV2N Strong Genetic Variation [3]
Stomach cancer DISKIJSX Strong Altered Expression [1]
Acute lymphocytic leukaemia DISPX75S moderate Altered Expression [4]
Melanoma DIS1RRCY moderate Genetic Variation [4]
Ovarian cancer DISZJHAP moderate Genetic Variation [4]
Lung adenocarcinoma DISD51WR Limited Genetic Variation [5]
Lung carcinoma DISTR26C Limited Genetic Variation [5]
Psoriasis DIS59VMN Limited Genetic Variation [6]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
8 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [7]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [9]
Estradiol DMUNTE3 Approved Estradiol decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [7]
Quercetin DM3NC4M Approved Quercetin decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [10]
Azathioprine DMMZSXQ Approved Azathioprine decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [11]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of PDZ domain-containing protein GIPC2 (GIPC2). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A affects the expression of PDZ domain-containing protein GIPC2 (GIPC2). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 affects the phosphorylation of PDZ domain-containing protein GIPC2 (GIPC2). [12]
------------------------------------------------------------------------------------

References

1 Up-regulation of GIPC2 in human gastric cancer.Int J Oncol. 2002 Jun;20(6):1183-7.
2 Molecular cloning and characterization of human GIPC2, a novel gene homologous to human GIPC1 and Xenopus Kermit.Int J Oncol. 2002 Mar;20(3):571-6.
3 Pleiotropic Meta-Analysis of Cognition, Education, and Schizophrenia Differentiates Roles of Early Neurodevelopmental and Adult Synaptic Pathways.Am J Hum Genet. 2019 Aug 1;105(2):334-350. doi: 10.1016/j.ajhg.2019.06.012.
4 Functional proteomics, human genetics and cancer biology of GIPC family members.Exp Mol Med. 2013 Jun 7;45(6):e26. doi: 10.1038/emm.2013.49.
5 Large-scale association analysis identifies new lung cancer susceptibility loci and heterogeneity in genetic susceptibility across histological subtypes.Nat Genet. 2017 Jul;49(7):1126-1132. doi: 10.1038/ng.3892. Epub 2017 Jun 12.
6 Large scale meta-analysis characterizes genetic architecture for common psoriasis associated variants.Nat Commun. 2017 May 24;8:15382. doi: 10.1038/ncomms15382.
7 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
8 Multiple microRNAs function as self-protective modules in acetaminophen-induced hepatotoxicity in humans. Arch Toxicol. 2018 Feb;92(2):845-858.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
11 A transcriptomics-based in vitro assay for predicting chemical genotoxicity in vivo. Carcinogenesis. 2012 Jul;33(7):1421-9.
12 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
13 Comprehensive analysis of transcriptomic changes induced by low and high doses of bisphenol A in HepG2 spheroids in vitro and rat liver in vivo. Environ Res. 2019 Jun;173:124-134. doi: 10.1016/j.envres.2019.03.035. Epub 2019 Mar 18.