Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT6AOG64)

• DOT Name: Protein FAM72B (FAM72B)
• Gene Name: FAM72B
• Related Disease:
  Hepatocellular carcinoma
  Adult lymphoma
  Advanced cancer
  Alzheimer disease
  Dementia
  Gastric cancer
  Hepatitis C virus infection
  HIV infectious disease
  Lymphoma
  Neoplasm
  Non-hodgkin lymphoma
  Pediatric lymphoma
  Pulmonary fibrosis
  Retinopathy
  Factor IX deficiency
  Epstein barr virus infection
• UniProt ID: FA72B_HUMAN
• Pfam ID: PF14976
• Sequence:
  MSTNICSFKDRCVSILCCKFCKQVLSSRGMKAVLLADTEIDLFSTDIPPTNAVDFTGRCY
  FTKICKCKLKDIACLKCGNIVGYHVIVPCSSCLPSCNNGHFWMFHSQAVYDINRLDSTGV
  NILLWGNLPEIEESTDEDVLNISAEECIR

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Hepatocellular carcinoma	DIS0J828	Definitive	Biomarker	[1]
Adult lymphoma	DISK8IZR	Strong	Genetic Variation	[2]
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[3]
Alzheimer disease	DISF8S70	Strong	Biomarker	[4]
Dementia	DISXL1WY	Strong	Biomarker	[5]
Gastric cancer	DISXGOUK	Strong	Genetic Variation	[6]
Hepatitis C virus infection	DISQ0M8R	Strong	Biomarker	[7]
HIV infectious disease	DISO97HC	Strong	Biomarker	[8]
Lymphoma	DISN6V4S	Strong	Genetic Variation	[2]
Neoplasm	DISZKGEW	Strong	Genetic Variation	[9]
Non-hodgkin lymphoma	DISS2Y8A	Strong	Biomarker	[10]
Pediatric lymphoma	DIS51BK2	Strong	Genetic Variation	[2]
Pulmonary fibrosis	DISQKVLA	Strong	Biomarker	[11]
Retinopathy	DISB4B0F	Strong	Biomarker	[12]
Factor IX deficiency	DISHN9SC	moderate	Biomarker	[13]
Epstein barr virus infection	DISOO0WT	Limited	Biomarker	[14]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein FAM72B (FAM72B).	[15]
Cisplatin	DMRHGI9	Approved	Cisplatin decreases the expression of Protein FAM72B (FAM72B).	[16]
Zoledronate	DMIXC7G	Approved	Zoledronate increases the expression of Protein FAM72B (FAM72B).	[17]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Protein FAM72B (FAM72B).	[18]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A decreases the expression of Protein FAM72B (FAM72B).	[19]
Sulforaphane	DMQY3L0	Investigative	Sulforaphane increases the expression of Protein FAM72B (FAM72B).	[20]

References

• [1] Computational discovery of niclosamide ethanolamine, a repurposed drug candidate that reduces growth of hepatocellular carcinoma cells initro and in mice by inhibiting cell division cycle 37 signaling. Gastroenterology. 2017 Jun;152(8):2022-2036.
• [2] Lymphomagenic properties of a HIV p17 variant derived from a splenic marginal zone lymphoma occurred in a HIV-infected patient.Hematol Oncol. 2019 Apr;37(2):176-184. doi: 10.1002/hon.2562. Epub 2018 Nov 6.
• [3] Mechanistic insights into avian reovirus p17-modulated suppression of cell cycle CDK-cyclin complexes and enhancement of p53 and cyclin H interaction.J Biol Chem. 2018 Aug 10;293(32):12542-12562. doi: 10.1074/jbc.RA118.002341. Epub 2018 Jun 15.
• [4] Identification and characterisation of the novel amyloid-beta peptide-induced protein p17.FEBS Lett. 2009 Oct 6;583(19):3247-53. doi: 10.1016/j.febslet.2009.09.018. Epub 2009 Sep 13.
• [5] p17 from HIV induces brain endothelial cell angiogenesis through EGFR-1-mediated cell signalling activation.Lab Invest. 2019 Feb;99(2):180-190. doi: 10.1038/s41374-018-0147-z. Epub 2018 Nov 2.
• [6] Inactivating mutations of the caspase-10 gene in gastric cancer.Oncogene. 2002 Apr 25;21(18):2919-25. doi: 10.1038/sj.onc.1205394.
• [7] Molecular characterization of human immunodeficiency virus type 1 and hepatitis C virus in paid blood donors and injection drug users in china.J Virol. 2004 Dec;78(24):13591-9. doi: 10.1128/JVI.78.24.13591-13599.2004.
• [8] A CXCR1 haplotype hampers HIV-1 matrix protein p17 biological activity.AIDS. 2014 Oct 23;28(16):2355-64. doi: 10.1097/QAD.0000000000000423.
• [9] A lymphomagenic role for HIV beyond immune suppression?.Blood. 2016 Mar 17;127(11):1403-9. doi: 10.1182/blood-2015-11-681411. Epub 2016 Jan 14.
• [10] In-depth analysis of compartmentalization of HIV-1 matrix protein p17 in PBMC and plasma.New Microbiol. 2017 Jan;40(1):58-61. Epub 2017 Jan 9.
• [11] Therapeutic effect of a peptide inhibitor of TGF- on pulmonary fibrosis.Cytokine. 2011 Mar;53(3):327-33. doi: 10.1016/j.cyto.2010.11.019. Epub 2010 Dec 23.
• [12] elemene inhibits oxygeninduced retinal neovascularization via promoting miR?7a and reducing VEGF expression.Mol Med Rep. 2019 Mar;19(3):2307-2316. doi: 10.3892/mmr.2019.9863. Epub 2019 Jan 15.
• [13] The genetic diversification of the HIV type 1 gag p17 gene in patients infected from a common source.AIDS Res Hum Retroviruses. 1995 Oct;11(10):1197-201. doi: 10.1089/aid.1995.11.1197.
• [14] A natural HIV p17 protein variant up-regulates the LMP-1 EBV oncoprotein and promotes the growth of EBV-infected B-lymphocytes: implications for EBV-driven lymphomagenesis in the HIV setting.Int J Cancer. 2015 Sep 15;137(6):1374-85. doi: 10.1002/ijc.29494. Epub 2015 Mar 9.
• [15] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [16] Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
• [17] Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
• [18] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [19] Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
• [20] Transcriptome and DNA methylation changes modulated by sulforaphane induce cell cycle arrest, apoptosis, DNA damage, and suppression of proliferation in human liver cancer cells. Food Chem Toxicol. 2020 Feb;136:111047. doi: 10.1016/j.fct.2019.111047. Epub 2019 Dec 12.