Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT922YCJ)

DOT Name Centrosomal protein of 128 kDa (CEP128)
Synonyms Cep128
Gene Name CEP128
Related Disease
Bladder cancer ( )
Glioma ( )
Graves disease ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Hashimoto thyroiditis ( )
UniProt ID
CE128_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Sequence
MAESSSESDHFRCRDRLSPWAARSTHRGTRSLPTVEVTEKVNTITSTLQDTSRNLRQVDQ
MLGRYREYSNGQAGAIEHLKESLEQSIDQLRSQRLLRNSGGRSISVTSLSASDLDGGTGS
ELHHFPPTSPLKDYGDPQGIKRMRSRTGVRFVQETDDMTQLHGFHQSLRDLSSEQIRLGD
DFNRELSRRSRSDAETKRALEELTEKLNEAQKQEVVSDRVERRLQELEREMRTERELVER
RQDQLGLMSLQLQEALKKQEAKADEHEGAIKNKLRQTETEKNQLEQELELSRRLLNQSEG
SRETLLHQVEELRTQLTKAEGDRKGLQHQVSQISKQQSNYQDEQGEDWRFRRGVEREKQD
LEKQMSDLRVQLNFSAMASELEEVKRCMERKDKEKAHLASQVENLTRELENGEKQQLQML
DRLKEIQNHFDTCEAERKHADLQISELTRHAEDATKQAERYLSELQQSEALKEEAEKRRE
DLKLKAQESIRQWKLKHKKLERALEKQSETVDELTGKNNQILKEKDELKTQLYAALQQIE
NLRKELNDVLTKRALQEEELHSKEEKLRDIKSHQADLELEVKNSLDTIHRLESELKKQSK
IQSQMKVEKAHLEEEIAELKKSQAQDKAKLLEMQESIKDLSAIRADLANKLAEEERAKKA
VLKDLSDLTAQAKSRDEETATIITQLKLERDVHQRELKDLTSSLQSVKTKHEQNIQELMK
HFKKEKSEAENHIRTLKAESLEEKNMAKIHRGQLEKLKSQCDRLTEELTQNENENKKLKL
KYQCLKDQLEEREKHISIEEEHLRRMEEARLQLKDQLLCLETEQESILGVIGKEIDAACK
TFSKDSVEKLKVFSSGPDIHYDPHRWLAESKTKLQWLCEELKERENREKNLRHQLMLCRQ
QLRNLTENKESELQCLFQQIERQEQLLDEIHREKRDLLEETQRKDEEMGSLQDRVIALET
STQVALDHLESVPEKLSLLEDFKDFRDSCSSSERTDGRYSKYRVRRNSLQHHQDDTKYRT
KSFKGDRTFLEGSHTRGLDHSSSWQDHSRFLSSPRFSYVNSFTKRTVAPDSASNKEDATM
NGTSSQPKKEEYGS

Molecular Interaction Atlas (MIA) of This DOT

6 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bladder cancer DISUHNM0 Strong Biomarker [1]
Glioma DIS5RPEH Strong Biomarker [2]
Graves disease DISU4KOQ Strong Biomarker [3]
Urinary bladder cancer DISDV4T7 Strong Biomarker [1]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [1]
Hashimoto thyroiditis DIS77CDF Limited Genetic Variation [3]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
15 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate decreases the expression of Centrosomal protein of 128 kDa (CEP128). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Centrosomal protein of 128 kDa (CEP128). [5]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Centrosomal protein of 128 kDa (CEP128). [6]
Acetaminophen DMUIE76 Approved Acetaminophen increases the expression of Centrosomal protein of 128 kDa (CEP128). [7]
Quercetin DM3NC4M Approved Quercetin increases the expression of Centrosomal protein of 128 kDa (CEP128). [8]
Calcitriol DM8ZVJ7 Approved Calcitriol decreases the expression of Centrosomal protein of 128 kDa (CEP128). [9]
Vorinostat DMWMPD4 Approved Vorinostat increases the expression of Centrosomal protein of 128 kDa (CEP128). [10]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Centrosomal protein of 128 kDa (CEP128). [9]
Dasatinib DMJV2EK Approved Dasatinib decreases the expression of Centrosomal protein of 128 kDa (CEP128). [11]
Urethane DM7NSI0 Phase 4 Urethane increases the expression of Centrosomal protein of 128 kDa (CEP128). [12]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Centrosomal protein of 128 kDa (CEP128). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 decreases the expression of Centrosomal protein of 128 kDa (CEP128). [14]
Formaldehyde DM7Q6M0 Investigative Formaldehyde decreases the expression of Centrosomal protein of 128 kDa (CEP128). [17]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Centrosomal protein of 128 kDa (CEP128). [18]
Manganese DMKT129 Investigative Manganese decreases the expression of Centrosomal protein of 128 kDa (CEP128). [19]
------------------------------------------------------------------------------------
⏷ Show the Full List of 15 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 increases the phosphorylation of Centrosomal protein of 128 kDa (CEP128). [15]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the methylation of Centrosomal protein of 128 kDa (CEP128). [16]
------------------------------------------------------------------------------------

References

1 Circular RNA CEP128 promotes bladder cancer progression by regulating Mir-145-5p/Myd88 via MAPK signaling pathway.Int J Cancer. 2019 Oct 15;145(8):2170-2181. doi: 10.1002/ijc.32311. Epub 2019 May 30.
2 Knockdown of circular RNA CEP128 suppresses proliferation and improves cytotoxic efficacy of temozolomide in glioma cells by regulating miR-145-5p.Neuroreport. 2019 Dec 18;30(18):1231-1238. doi: 10.1097/WNR.0000000000001326.
3 CEP128 is a crucial risk locus for autoimmune thyroid diseases.Mol Cell Endocrinol. 2019 Jan 15;480:97-106. doi: 10.1016/j.mce.2018.10.017. Epub 2018 Oct 27.
4 Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
5 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
6 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
7 Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
8 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
9 Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
10 Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
11 Dasatinib reverses cancer-associated fibroblasts (CAFs) from primary lung carcinomas to a phenotype comparable to that of normal fibroblasts. Mol Cancer. 2010 Jun 27;9:168.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Transcriptional signature of human macrophages exposed to the environmental contaminant benzo(a)pyrene. Toxicol Sci. 2010 Apr;114(2):247-59.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
16 DNA methylome-wide alterations associated with estrogen receptor-dependent effects of bisphenols in breast cancer. Clin Epigenetics. 2019 Oct 10;11(1):138. doi: 10.1186/s13148-019-0725-y.
17 Characterization of formaldehyde's genotoxic mode of action by gene expression analysis in TK6 cells. Arch Toxicol. 2013 Nov;87(11):1999-2012.
18 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
19 Gene expression profiling of human primary astrocytes exposed to manganese chloride indicates selective effects on several functions of the cells. Neurotoxicology. 2007 May;28(3):478-89.