Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OT9GTOAC)

• DOT Name: Nitric oxide-associated protein 1 (NOA1)
• Gene Name: NOA1
• Related Disease:
  Coronary heart disease
  Neuroblastoma
• UniProt ID: NOA1_HUMAN
• PDB ID: 8CSP
• Pfam ID: PF01926 ; PF21516
• Sequence:
  MLPARLPFRLLSLFLRGSAPTAARHGLREPLLERRCAAASSFQHSSSLGRELPYDPVDTE
  GFGEGGDMQERFLFPEYILDPEPQPTREKQLQELQQQQEEEERQRQQRREERRQQNLRAR
  SREHPVVGHPDPALPPSGVNCSGCGAELHCQDAGVPGYLPREKFLRTAEADGGLARTVCQ
  RCWLLSHHRRALRLQVSREQYLELVSAALRRPGPSLVLYMVDLLDLPDALLPDLPALVGP
  KQLIVLGNKVDLLPQDAPGYRQRLRERLWEDCARAGLLLAPGHQGPQRPVKDEPQDGENP
  NPPNWSRTVVRDVRLISAKTGYGVEELISALQRSWRYRGDVYLVGATNAGKSTLFNTLLE
  SDYCTAKGSEAIDRATISPWPGTTLNLLKFPICNPTPYRMFKRHQRLKKDSTQAEEDLSE
  QEQNQLNVLKKHGYVVGRVGRTFLYSEEQKDNIPFEFDADSLAFDMENDPVMGTHKSTKQ
  VELTAQDVKDAHWFYDTPGITKENCILNLLTEKEVNIVLPTQSIVPRTFVLKPGMVLFLG
  AIGRIDFLQGNQSAWFTVVASNILPVHITSLDRADALYQKHAGHTLLQIPMGGKERMAGF
  PPLVAEDIMLKEGLGASEAVADIKFSSAGWVSVTPNFKDRLHLRGYTPEGTVLTVRPPLL
  PYIVNIKGQRIKKSVAYKTKKPPSLMYNVRKKKGKINV
• Function: Involved in regulation of mitochondrial protein translation and respiration. Plays a role in mitochondria-mediated cell death. May act as a scaffolding protein or stabilizer of respiratory chain supercomplexes. Binds GTP.

Molecular Interaction Atlas (MIA) of This DOT

2 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Coronary heart disease	DIS5OIP1	moderate	Genetic Variation	[1]
Neuroblastoma	DISVZBI4	moderate	Biomarker	[2]

6 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate affects the expression of Nitric oxide-associated protein 1 (NOA1).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Nitric oxide-associated protein 1 (NOA1).	[4]
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of Nitric oxide-associated protein 1 (NOA1).	[5]
Carbamazepine	DMZOLBI	Approved	Carbamazepine affects the expression of Nitric oxide-associated protein 1 (NOA1).	[3]
Menadione	DMSJDTY	Approved	Menadione affects the expression of Nitric oxide-associated protein 1 (NOA1).	[6]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of Nitric oxide-associated protein 1 (NOA1).	[7]

References

• [1] Identification of 64 Novel Genetic Loci Provides an Expanded View on the Genetic Architecture of Coronary Artery Disease.Circ Res. 2018 Feb 2;122(3):433-443. doi: 10.1161/CIRCRESAHA.117.312086. Epub 2017 Dec 6.
• [2] mAtNOS1 regulates mitochondrial functions and apoptosis of human neuroblastoma cells.Biochim Biophys Acta. 2008 Jun;1780(6):921-6. doi: 10.1016/j.bbagen.2008.02.006. Epub 2008 Mar 4.
• [3] Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
• [4] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [5] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [6] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [7] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.