Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTAUSTUK)

• DOT Name: POTE ankyrin domain family member D (POTED)
• Synonyms: ANKRD26-like family B member 3; Ankyrin repeat domain-containing protein 21; Prostate, ovary, testis-expressed protein; Protein POTE
• Gene Name: POTED
• Related Disease:
  Advanced cancer
  Breast cancer
  Breast carcinoma
  Colorectal carcinoma
  Epithelial ovarian cancer
  Neoplasm
  Ovarian cancer
  Ovarian neoplasm
  Polyarteritis nodosa
  Prostate cancer
  Prostate carcinoma
  Testicular cancer
  Vasculitis due to ADA2 deficiency
• UniProt ID: POTED_HUMAN
• Pfam ID: PF12796 ; PF14915
• Sequence:
  MVAEVCSMPTASTVKKPFDLRSKMGKWCHHRFPCCRGSGKSNMGTSGDHDDSFMKMLRSK
  MGKCCRHCFPCCRGSGTSNVGTSGDHENSFMKMLRSKMGKWCCHCFPCCRGSGKSNVGAW
  GDYDHSAFMEPRYHIRREDLDKLHRAAWWGKVPRKDLIVMLRDTDMNKRDKEKRTALHLA
  SANGNSEVVQLLLDRRCQLNVLDNKKRTALIKAIQCQEDECVLMLLEHGADRNIPDEYGN
  TALHYAIYNEDKLMAKALLLYGADIESKNKCGLTPLLLGVHEQKQQVVKFLIKKKANLNV
  LDRYGRTALILAVCCGSASIVNLLLEQNVDVSSQDLSGQTAREYAVSSHHHVICELLSDY
  KEKQMLKISSENSNPEQDLKLTSEEESQRLKVSENSQPEKMSQEPEINKDCDREVEEEIK
  KHGSNPVGLPENLTNGASAGNGDDGLIPQRRSRKPENQQFPDTENEEYHSDEQNDTRKQL
  SEEQNTGISQDEILTNKQKQIEVAEQKMNSELSLSHKKEEDLLRENSVLQEEIAMLRLEL
  DETKHQNQLRENKILEEIESVKEKTDKLLRAMQLNEEALTKTNI
• Tissue Specificity: Expressed in prostate, ovary, testis, placenta and prostate cancer cell lines. Localizes to basal and terminal prostate epithelial cells.

Molecular Interaction Atlas (MIA) of This DOT

13 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Advanced cancer	DISAT1Z9	Strong	Altered Expression	[1]
Breast cancer	DIS7DPX1	Strong	Altered Expression	[2]
Breast carcinoma	DIS2UE88	Strong	Altered Expression	[2]
Colorectal carcinoma	DIS5PYL0	Strong	Altered Expression	[3]
Epithelial ovarian cancer	DIS56MH2	Strong	Biomarker	[1]
Neoplasm	DISZKGEW	Strong	Altered Expression	[4]
Ovarian cancer	DISZJHAP	Strong	Biomarker	[1]
Ovarian neoplasm	DISEAFTY	Strong	Biomarker	[1]
Polyarteritis nodosa	DISRQ5X8	Strong	Altered Expression	[4]
Prostate cancer	DISF190Y	Strong	Biomarker	[5]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[5]
Testicular cancer	DIS6HNYO	Strong	Biomarker	[1]
Vasculitis due to ADA2 deficiency	DIS1UHPY	Strong	Altered Expression	[4]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of POTE ankyrin domain family member D (POTED).	[6]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of POTE ankyrin domain family member D (POTED).	[9]

4 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Acetaminophen	DMUIE76	Approved	Acetaminophen decreases the expression of POTE ankyrin domain family member D (POTED).	[7]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of POTE ankyrin domain family member D (POTED).	[8]
PIRINIXIC ACID	DM82Y75	Preclinical	PIRINIXIC ACID decreases the expression of POTE ankyrin domain family member D (POTED).	[10]
2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE	DMNQL17	Investigative	2-AMINO-1-METHYL-6-PHENYLIMIDAZO[4,5-B]PYRIDINE decreases the expression of POTE ankyrin domain family member D (POTED).	[11]

References

• [1] Epigenetic activation of POTE genes in ovarian cancer.Epigenetics. 2019 Feb;14(2):185-197. doi: 10.1080/15592294.2019.1581590. Epub 2019 Mar 4.
• [2] POTE paralogs are induced and differentially expressed in many cancers.Cancer Res. 2006 Jan 1;66(1):52-6. doi: 10.1158/0008-5472.CAN-05-3014.
• [3] POTEE drives colorectal cancer development via regulating SPHK1/p65 signaling.Cell Death Dis. 2019 Nov 13;10(11):863. doi: 10.1038/s41419-019-2046-7.
• [4] Expression of the POTE gene family in human ovarian cancer.Sci Rep. 2018 Nov 20;8(1):17136. doi: 10.1038/s41598-018-35567-1.
• [5] POTE, a highly homologous gene family located on numerous chromosomes and expressed in prostate, ovary, testis, placenta, and prostate cancer.Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16975-80. doi: 10.1073/pnas.262655399. Epub 2002 Dec 10.
• [6] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [7] Blood transcript immune signatures distinguish a subset of people with elevated serum ALT from others given acetaminophen. Clin Pharmacol Ther. 2016 Apr;99(4):432-41.
• [8] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [9] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [10] Immunoselection and characterization of a human genomic PPAR binding fragment located within POTE genes. Biochimie. 2007 Mar;89(3):329-36. doi: 10.1016/j.biochi.2006.09.017. Epub 2006 Oct 18.
• [11] Preferential induction of the AhR gene battery in HepaRG cells after a single or repeated exposure to heterocyclic aromatic amines. Toxicol Appl Pharmacol. 2010 Nov 15;249(1):91-100.