General Information of Drug Off-Target (DOT) (ID: OTB4JWN3)

DOT Name DmX-like protein 2 (DMXL2)
Synonyms Rabconnectin-3
Gene Name DMXL2
Related Disease
Developmental and epileptic encephalopathy, 81 ( )
Epileptic encephalopathy ( )
Infantile epileptic-dyskinetic encephalopathy ( )
Joubert syndrome ( )
Psoriasis ( )
Sensorineural hearing loss disorder ( )
Hearing loss, autosomal recessive ( )
Stroke ( )
Autosomal dominant nonsyndromic hearing loss ( )
Infantile spasm ( )
Polyendocrine-polyneuropathy syndrome ( )
Intellectual disability ( )
Autism spectrum disorder ( )
Breast cancer ( )
Breast carcinoma ( )
Hearing loss, autosomal dominant 71 ( )
Neurodevelopmental disorder ( )
Nonsyndromic genetic hearing loss ( )
Pervasive developmental disorder ( )
UniProt ID
DMXL2_HUMAN
Pfam ID
PF12234 ; PF00400
Sequence
MHLHQVLTGAVNPGDNCYSVGSVGDVPFTAYGSGCDIVILANDFECVQIIPGAKHGNIQV
SCVECSNQQGRIAASYGNAVCIFEPLGINSHKRNCQLKCQWLKTGQFFLSSVTYNLAWDP
QDNRLLTATDSIQLWAPPGDDILEEEEEIDNTVPPVLNDWKCVWQCKTSVSVHLMEWSPD
GEYFATAGKDDCLLKVWYPMTGWKSSIIPQDHHEVKRRQSSTQFSFVYLAHPRAVTGFSW
RKTSKYMPRGSVCNVLLTSCHDGVCRLWAETLLPEDCLLGEQICETTTSSIASSLSHAGR
HKDRIQHALETIHHLKNLRKGQRRSSVLVTHAELMPDQTAMHEVQRHISHHANALCHFHI
AASINPATDIPNVLVGTAFNVDDGNGGFVVHWLNNKEFHFTSSTEVFMHQLRKLSDKQVD
HENDDADREDEEHSQEDRERGLHMKLDHDLSLDRESEAGTGSSEHEDGEREGSPRTYSRL
SVPMPLPTVLLDRKIETLLTEWNKNPDMLFTIHPVDGTFLVWHVKYLDEYNPGIFRQVQV
SFSSRIPVAFPSGDASSLSKNIMMYACINATKDSHHTLLHQEGMSVGSPHGSQPHSRSHS
THMNILAPTVMMISKHIDGSLNQWAVTFADKSAFTTVLTVSHKFRYCGHRFHLNDLACHS
VLPLLLTSSHHNALLTPELDCQWDSDNKLSRLMDPVKHIKGSSKQPLRNAATRTFHDPNA
IYSELILWRVDPIGPLSYTGGVSELARINSLHTSAFSNVAWLPTLIPSYCLGTYCNSASA
CFVASDGKNLRLYQAVVDARKLLDELSDPESSKLIGEVFNIVSQQSTARPGCIIELDAIT
NQCGSNTQLLHVFQEDFIIGYKPHKEDMEKKETEIFFQPSQGYRPPPFSEKFFLVVIEKD
SNNNSILHMWHLHLKSVQACLAKASEGASSESLLSVPGQKNVDSSPETSPSVSPMPHSSS
IANLQTASKLILSSRLVYSQPLDLPESVEVIRATPSAGHLSSSSIYPVCLAPYLVVTTCS
DNKVRFWKCCMEANPECNKSDEKEIYHWKRWPLMNDEGEDNSSTVSIVGRPVAVSCSYTG
RLAVAYKQPIHHNGFVSKEFSMHVCIFECESTGGSEWVLEQTIHLDDLVKVGSVLDSRVS
VDSNLFVYSKSDALLSKDRYLIPNIKHLVHLDWVSKEDGSHILTVGVGANIFMYGRLSGI
VTEQTNSKDGVAVITLPLGGSIKQGVKSRWVLLRSIDLVSSVDGTPSLPVSLSWVRDGIL
VVGMDCEMHVYAQWKHAVKFGDTEADSSNAEEAAMQDHSTFKSNMLARKSVVEGTAISDD
VFCSPTVIQDGGLFEAAHVLSPTLPQYHPTQLLELMDLGKVRRAKAILSHLVKCIAGEVA
IVRDPDAGEGTKRHLSRTISVSGSTAKETVTVGKDGTRDYTEIDSIPPLPLYALLAADQD
TSYRISEESTKIPQSYEDQTVSQPEDQYSELFQIQDIPTDDIDLEPEKRENKSKVINLSQ
YGPAYFGQEHARVLSSHLMHSSLPGLTRLEQMFLVALADTVATTSTELDESRDKSCSGRD
TLDECGLRYLLAMRLHTCLLTSLPPLYRVQLLHQGVSTCHFAWAFHSEAEEELINMIPAI
QRGDPQWSELRAMGIGWWVRNINTLRRCIEKVAKASFQRNNDALDAALFYLSMKKKAVVW
GLFRSQHDEKMTTFFSHNFNEDRWRKAALKNAFSLLGKQRFEQSAAFFLLAGSLKDAIEV
CLEKMEDIQLAMVIARLYESEFETSSTYISILNQKILGCQKDGSGFSCKRLHPDPFLRSL
AYWVMKDYTRALDTLLEQTPKEDDEHQVIIKSCNPVAFSFYNYLRTHPLLIRRNLASPEG
TLATLGLKTEKNFVDKINLIERKLFFTTANAHFKVGCPVLALEVLSKIPKVTKTSALSAK
KDQPDFISHRMDDVPSHSKALSDGNGSSGIEWSNVTSSQYDWSQPIVKVDEEPLNLDWGE
DHDSALDEEEDDAVGLVMKSTDAREKDKQSDQKASDPNMLLTPQEEDDPEGDTEVDVIAE
QLKFRACLKILMTELRTLATGYEVDGGKLRFQLYNWLEKEIAALHEICNHESVIKEYSSK
TYSKVESDLLDQEEMVDKPDIGSYERHQIERRRLQAKREHAERRKSWLQKNQDLLRVFLS
YCSLHGAQGGGLASVRMELKFLLQESQQETTVKQLQSPLPLPTTLPLLSASIASTKTVIA
NPVLYLNNHIHDILYTIVQMKTPPHPSIEDVKVHTLHSLAASLSASIYQALCDSHSYSQT
EGNQFTGMAYQGLLLSDRRRLRTESIEEHATPNSSPAQWPGVSSLINLLSSAQDEDQPKL
NILLCEAVVAVYLSLLIHALATNSSSELFRLAAHPLNNRMWAAVFGGGVKLVVKPRRQSE
NISAPPVLSEDIDKHRRRFNMRMLVPGRPVKDATPPPVPAERPSYKEKFIPPELSMWDYF
VAKPFLPLSDSGVIYDSDESIHSDEEDDAFFSDTQIQEHQDPNSYSWALLHLTMVKLALH
NVKNFFPIAGLEFSELPVTSPLGIAVIKNLENWEQILQEKMDQFEGPPPNYINTYPTDLS
VGAGPAILRNKAMLEPENTPFKSRDSSAFPVKRLWHFLVKQEVLQETFIRYIFTKKRKQS
EVEADLGYPGGKAKVIHKESDMIMAFSVNKANCNEIVLASTHDVQELDVTSLLACQSYIW
IGEEYDRESKSSDDVDYRGSTTTLYQPSATSYSASQVHPPSSLPWLGTGQTSTGASVLMK
RNLHNVKRMTSHPVHQYYLTGAQDGSVRMFEWTRPQQLVCFRQAGNARVTRLYFNSQGNK
CGVADGEGFLSIWQVNQTASNPKPYMSWQCHSKATSDFAFITSSSLVATSGHSNDNRNVC
LWDTLISPGNSLIHGFTCHDHGATVLQYAPKQQLLISGGRKGHVCIFDIRQRQLIHTFQA
HDSAIKALALDPYEEYFTTGSAEGNIKVWRLTGHGLIHSFKSEHAKQSIFRNIGAGVMQI
DIIQGNRLFSCGADGTLKTRVLPNAFNIPNRILDIL
Function May serve as a scaffold protein for MADD and RAB3GA on synaptic vesicles. Plays a role in the brain as a key controller of neuronal and endocrine homeostatic processes.
KEGG Pathway
Lysosome (hsa04142 )

Molecular Interaction Atlas (MIA) of This DOT

19 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Developmental and epileptic encephalopathy, 81 DISTIKTG Strong Autosomal recessive [1]
Epileptic encephalopathy DISZOCA3 Strong Genetic Variation [2]
Infantile epileptic-dyskinetic encephalopathy DISD2ZNC Strong Genetic Variation [2]
Joubert syndrome DIS7P5CO Strong Genetic Variation [3]
Psoriasis DIS59VMN Strong Biomarker [4]
Sensorineural hearing loss disorder DISJV45Z Strong Biomarker [2]
Hearing loss, autosomal recessive DIS8G9R9 moderate Biomarker [5]
Stroke DISX6UHX moderate Biomarker [6]
Autosomal dominant nonsyndromic hearing loss DISYC1G0 Supportive Autosomal dominant [5]
Infantile spasm DISZSKDG Supportive Autosomal dominant [2]
Polyendocrine-polyneuropathy syndrome DISYGT3D Supportive Autosomal recessive [7]
Intellectual disability DISMBNXP Disputed Biomarker [8]
Autism spectrum disorder DISXK8NV Limited Genetic Variation [9]
Breast cancer DIS7DPX1 Limited Altered Expression [10]
Breast carcinoma DIS2UE88 Limited Altered Expression [10]
Hearing loss, autosomal dominant 71 DISTYHRQ Limited Autosomal dominant [11]
Neurodevelopmental disorder DIS372XH Limited Biomarker [9]
Nonsyndromic genetic hearing loss DISZX61P Limited Autosomal dominant [12]
Pervasive developmental disorder DIS51975 Limited Genetic Variation [9]
------------------------------------------------------------------------------------
⏷ Show the Full List of 19 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
13 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of DmX-like protein 2 (DMXL2). [13]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of DmX-like protein 2 (DMXL2). [14]
Tretinoin DM49DUI Approved Tretinoin increases the expression of DmX-like protein 2 (DMXL2). [15]
Acetaminophen DMUIE76 Approved Acetaminophen decreases the expression of DmX-like protein 2 (DMXL2). [16]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of DmX-like protein 2 (DMXL2). [17]
Cisplatin DMRHGI9 Approved Cisplatin increases the expression of DmX-like protein 2 (DMXL2). [18]
Ivermectin DMDBX5F Approved Ivermectin decreases the expression of DmX-like protein 2 (DMXL2). [19]
Quercetin DM3NC4M Approved Quercetin decreases the expression of DmX-like protein 2 (DMXL2). [20]
Methotrexate DM2TEOL Approved Methotrexate increases the expression of DmX-like protein 2 (DMXL2). [21]
Selenium DM25CGV Approved Selenium decreases the expression of DmX-like protein 2 (DMXL2). [22]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of DmX-like protein 2 (DMXL2). [23]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of DmX-like protein 2 (DMXL2). [25]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of DmX-like protein 2 (DMXL2). [13]
------------------------------------------------------------------------------------
⏷ Show the Full List of 13 Drug(s)
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of DmX-like protein 2 (DMXL2). [24]
Coumarin DM0N8ZM Investigative Coumarin decreases the phosphorylation of DmX-like protein 2 (DMXL2). [24]
------------------------------------------------------------------------------------

References

1 Autozygome and high throughput confirmation of disease genes candidacy. Genet Med. 2019 Mar;21(3):736-742. doi: 10.1038/s41436-018-0138-x. Epub 2018 Sep 21.
2 Biallelic DMXL2 mutations impair autophagy and cause Ohtahara syndrome with progressive course. Brain. 2019 Dec 1;142(12):3876-3891. doi: 10.1093/brain/awz326.
3 Mice with a conditional deletion of Talpid3 (KIAA0586)-a model for Joubert syndrome.J Pathol. 2019 Aug;248(4):396-408. doi: 10.1002/path.5271. Epub 2019 May 16.
4 Does imiquimod pretreatment optimize 308-nm excimer laser (UVB) therapy in psoriasis patients?.Photodermatol Photoimmunol Photomed. 2017 Jul;33(4):193-202. doi: 10.1111/phpp.12299. Epub 2017 Apr 20.
5 A dominant variant in DMXL2 is linked to nonsyndromic hearing loss. Genet Med. 2017 May;19(5):553-558. doi: 10.1038/gim.2016.142. Epub 2016 Sep 22.
6 Gene variants associated with ischemic stroke: the cardiovascular health study.Stroke. 2009 Feb;40(2):363-8. doi: 10.1161/STROKEAHA.108.521328. Epub 2008 Nov 20.
7 Haploinsufficiency of Dmxl2, encoding a synaptic protein, causes infertility associated with a loss of GnRH neurons in mouse. PLoS Biol. 2014 Sep 23;12(9):e1001952. doi: 10.1371/journal.pbio.1001952. eCollection 2014 Sep.
8 Dynamic Regulation of Hypothalamic DMXL2, KISS1, and RFRP Expression During Postnatal Development in Non-Human Primates.Mol Neurobiol. 2017 Dec;54(10):8447-8457. doi: 10.1007/s12035-016-0329-x. Epub 2016 Dec 12.
9 Rare copy number variations affecting the synaptic gene DMXL2 in neurodevelopmental disorders.J Neurodev Disord. 2019 Feb 7;11(1):3. doi: 10.1186/s11689-019-9263-3.
10 DMXL2 drives epithelial to mesenchymal transition in hormonal therapy resistant breast cancer through Notch hyper-activation.Oncotarget. 2015 Sep 8;6(26):22467-79. doi: 10.18632/oncotarget.4164.
11 The Gene Curation Coalition: A global effort to harmonize gene-disease evidence resources. Genet Med. 2022 Aug;24(8):1732-1742. doi: 10.1016/j.gim.2022.04.017. Epub 2022 May 4.
12 Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
13 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
14 Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
15 Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
16 Gene expression analysis of precision-cut human liver slices indicates stable expression of ADME-Tox related genes. Toxicol Appl Pharmacol. 2011 May 15;253(1):57-69.
17 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
18 Low doses of cisplatin induce gene alterations, cell cycle arrest, and apoptosis in human promyelocytic leukemia cells. Biomark Insights. 2016 Aug 24;11:113-21.
19 Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
20 Comparison of phenotypic and transcriptomic effects of false-positive genotoxins, true genotoxins and non-genotoxins using HepG2 cells. Mutagenesis. 2011 Sep;26(5):593-604.
21 The contribution of methotrexate exposure and host factors on transcriptional variance in human liver. Toxicol Sci. 2007 Jun;97(2):582-94.
22 Selenium and vitamin E: cell type- and intervention-specific tissue effects in prostate cancer. J Natl Cancer Inst. 2009 Mar 4;101(5):306-20.
23 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
24 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
25 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.