Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBNQCOS)

DOT Name Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3)
Synonyms CD85 antigen-like family member E; Immunoglobulin-like transcript 6; ILT-6; Leukocyte immunoglobulin-like receptor 4; LIR-4; Monocyte inhibitory receptor HM43/HM31; CD antigen CD85e
Gene Name LILRA3
Related Disease
Autoimmune disease ( )
HIV infectious disease ( )
Leukopenia ( )
Sjogren syndrome ( )
Systemic lupus erythematosus ( )
Thrombocytopenia ( )
Benign prostatic hyperplasia ( )
Prostate cancer ( )
Prostate carcinoma ( )
Rheumatoid arthritis ( )
UniProt ID
LIRA3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
3Q2C
Pfam ID
PF13895
Sequence
MTPILTVLICLGLSLDPRTHVQAGPLPKPTLWAEPGSVITQGSPVTLRCQGSLETQEYHL
YREKKTALWITRIPQELVKKGQFPILSITWEHAGRYCCIYGSHTAGLSESSDPLELVVTG
AYSKPTLSALPSPVVTSGGNVTIQCDSQVAFDGFILCKEGEDEHPQCLNSHSHARGSSRA
IFSVGPVSPSRRWSYRCYGYDSRAPYVWSLPSDLLGLLVPGVSKKPSLSVQPGPVVAPGE
KLTFQCGSDAGYDRFVLYKEWGRDFLQRPGRQPQAGLSQANFTLGPVSRSYGGQYTCSGA
YNLSSEWSAPSDPLDILITGQIRARPFLSVRPGPTVASGENVTLLCQSQGGMHTFLLTKE
GAADSPLRLKSKRQSHKYQAEFPMSPVTSAHAGTYRCYGSLSSNPYLLTHPSDPLELVVS
GAAETLSPPQNKSDSKAGE
Function
Acts as a soluble receptor for class I MHC antigens. Binds both classical and non-classical HLA class I molecules but with reduced affinities compared to LILRB1 or LILRB2. Binds with high affinity to the surface of monocytes, leading to abolish LPS-induced TNF-alpha production by monocytes.
Tissue Specificity Detected in B-cells, and at lower levels in natural killer (NK) cells. Detected in peripheral blood monocytes and lung.
KEGG Pathway
Osteoclast differentiation (hsa04380 )
B cell receptor sig.ling pathway (hsa04662 )
Reactome Pathway
Neutrophil degranulation (R-HSA-6798695 )
Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell (R-HSA-198933 )

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Autoimmune disease DISORMTM Strong Biomarker [1]
HIV infectious disease DISO97HC Strong Genetic Variation [2]
Leukopenia DISJMBMM Strong Biomarker [1]
Sjogren syndrome DISUBX7H Strong Biomarker [3]
Systemic lupus erythematosus DISI1SZ7 Strong Biomarker [4]
Thrombocytopenia DISU61YW Strong Altered Expression [4]
Benign prostatic hyperplasia DISI3CW2 moderate Biomarker [5]
Prostate cancer DISF190Y moderate Genetic Variation [5]
Prostate carcinoma DISMJPLE moderate Genetic Variation [5]
Rheumatoid arthritis DISTSB4J moderate Genetic Variation [1]
------------------------------------------------------------------------------------
⏷ Show the Full List of 10 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
4 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Tretinoin DM49DUI Approved Tretinoin increases the expression of Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3). [6]
Methotrexate DM2TEOL Approved Methotrexate decreases the expression of Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3). [7]
Tamibarotene DM3G74J Phase 3 Tamibarotene increases the expression of Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3). [6]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 increases the expression of Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3). [9]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Leukocyte immunoglobulin-like receptor subfamily A member 3 (LILRA3). [8]
------------------------------------------------------------------------------------

References

1 Impact of the leucocyte immunoglobulin-like receptor A3 (LILRA3) on susceptibility and subphenotypes of systemic lupus erythematosus and Sjgren's syndrome.Ann Rheum Dis. 2015 Nov;74(11):2070-5. doi: 10.1136/annrheumdis-2013-204441. Epub 2014 Jun 6.
2 LILRA3 deletion is a genetic risk factor of HIV infection.AIDS. 2017 Jan 2;31(1):25-34. doi: 10.1097/QAD.0000000000001304.
3 Genetic contributors and soluble mediators in prediction of autoimmune comorbidity.J Autoimmun. 2019 Nov;104:102317. doi: 10.1016/j.jaut.2019.102317. Epub 2019 Aug 20.
4 The expression and clinical significance of different forms of LILRA3 in systemic lupus erythematosus.Clin Rheumatol. 2019 Nov;38(11):3099-3107. doi: 10.1007/s10067-019-04624-z. Epub 2019 Jun 17.
5 LILRA3 is associated with benign prostatic hyperplasia risk in a Chinese Population.Int J Mol Sci. 2013 Apr 24;14(5):8832-40. doi: 10.3390/ijms14058832.
6 Differential modulation of PI3-kinase/Akt pathway during all-trans retinoic acid- and Am80-induced HL-60 cell differentiation revealed by DNA microarray analysis. Biochem Pharmacol. 2004 Dec 1;68(11):2177-86.
7 Global molecular effects of tocilizumab therapy in rheumatoid arthritis synovium. Arthritis Rheumatol. 2014 Jan;66(1):15-23.
8 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
9 CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.