Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBSJEAG)

• DOT Name: RAD52 motif-containing protein 1 (RDM1)
• Synonyms: RAD52 homolog B
• Gene Name: RDM1
• Related Disease:
  Breast cancer
  Breast carcinoma
  Hepatocellular carcinoma
  Lung adenocarcinoma
  Lung cancer
  Lung carcinoma
  Lung neoplasm
  Non-small-cell lung cancer
  Neuroblastoma
  Neoplasm
• UniProt ID: RDM1_HUMAN
• Pfam ID: PF00076
• Sequence:
  MAELVPFAVPIESDKTLLVWELSSGPTAEALHHSLFTAFSQFGLLYSVRVFPNAAVAHPG
  FYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANY
  YFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLV
  EEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGV
  RCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD
• Function: May confer resistance to the antitumor agent cisplatin. Binds to DNA and RNA.
• Tissue Specificity: Expressed in testis.

Molecular Interaction Atlas (MIA) of This DOT

10 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Breast cancer	DIS7DPX1	Strong	Biomarker	[1]
Breast carcinoma	DIS2UE88	Strong	Biomarker	[1]
Hepatocellular carcinoma	DIS0J828	Strong	Biomarker	[2]
Lung adenocarcinoma	DISD51WR	Strong	Biomarker	[3]
Lung cancer	DISCM4YA	Strong	Altered Expression	[4]
Lung carcinoma	DISTR26C	Strong	Altered Expression	[4]
Lung neoplasm	DISVARNB	Strong	Altered Expression	[3]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Biomarker	[4]
Neuroblastoma	DISVZBI4	Disputed	Biomarker	[5]
Neoplasm	DISZKGEW	Limited	Biomarker	[2]

12 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[6]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of RAD52 motif-containing protein 1 (RDM1).	[8]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of RAD52 motif-containing protein 1 (RDM1).	[9]
Calcitriol	DM8ZVJ7	Approved	Calcitriol decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[10]
Vorinostat	DMWMPD4	Approved	Vorinostat increases the expression of RAD52 motif-containing protein 1 (RDM1).	[11]
Testosterone	DM7HUNW	Approved	Testosterone decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of RAD52 motif-containing protein 1 (RDM1).	[8]
Urethane	DM7NSI0	Phase 4	Urethane decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[12]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[13]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of RAD52 motif-containing protein 1 (RDM1).	[15]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A decreases the expression of RAD52 motif-containing protein 1 (RDM1).	[16]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene affects the methylation of RAD52 motif-containing protein 1 (RDM1).	[14]

References

• [1] RDM1 promotes critical processes in breast cancer tumorigenesis.J Cell Mol Med. 2019 Aug;23(8):5432-5439. doi: 10.1111/jcmm.14425. Epub 2019 Jun 20.
• [2] Loss of RDM1 enhances hepatocellular carcinoma progression via p53 and Ras/Raf/ERK pathways.Mol Oncol. 2020 Feb;14(2):373-386. doi: 10.1002/1878-0261.12593. Epub 2019 Dec 19.
• [3] RDM1 plays an oncogenic role in human lung adenocarcinoma cells.Sci Rep. 2018 Aug 1;8(1):11525. doi: 10.1038/s41598-018-30071-y.
• [4] RAD52 motifcontaining protein1 promotes nonsmall cell lung cancer cell proliferation and survival via cell cycle regulation.Oncol Rep. 2018 Aug;40(2):833-840. doi: 10.3892/or.2018.6459. Epub 2018 May 23.
• [5] RDM1 promotes neuroblastoma growth through the RAS-Raf-MEK-ERK pathway.FEBS Open Bio. 2019 Jan 28;9(3):490-497. doi: 10.1002/2211-5463.12586. eCollection 2019 Mar.
• [6] Human embryonic stem cell-derived test systems for developmental neurotoxicity: a transcriptomics approach. Arch Toxicol. 2013 Jan;87(1):123-43.
• [7] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [8] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [9] Global gene expression analysis reveals differences in cellular responses to hydroxyl- and superoxide anion radical-induced oxidative stress in caco-2 cells. Toxicol Sci. 2010 Apr;114(2):193-203. doi: 10.1093/toxsci/kfp309. Epub 2009 Dec 31.
• [10] Effects of 1alpha,25 dihydroxyvitamin D3 and testosterone on miRNA and mRNA expression in LNCaP cells. Mol Cancer. 2011 May 18;10:58.
• [11] Definition of transcriptome-based indices for quantitative characterization of chemically disturbed stem cell development: introduction of the STOP-Toxukn and STOP-Toxukk tests. Arch Toxicol. 2017 Feb;91(2):839-864.
• [12] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [13] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [14] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [15] Characterization of the Molecular Alterations Induced by the Prolonged Exposure of Normal Colon Mucosa and Colon Cancer Cells to Low-Dose Bisphenol A. Int J Mol Sci. 2022 Oct 1;23(19):11620. doi: 10.3390/ijms231911620.
• [16] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.