Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBUHHK3)

DOT Name T-cell leukemia homeobox protein 3 (TLX3)
Synonyms Homeobox protein Hox-11L2
Gene Name TLX3
Related Disease
Adult T-cell leukemia/lymphoma ( )
Hepatocellular carcinoma ( )
Acute leukaemia ( )
Acute lymphocytic leukaemia ( )
Bladder cancer ( )
Central hypoventilation syndrome, congenital ( )
Hirschsprung disease ( )
Leukemia ( )
Neoplasm ( )
T-cell leukaemia ( )
Urinary bladder cancer ( )
Urinary bladder neoplasm ( )
Childhood acute lymphoblastic leukemia ( )
Chromosomal disorder ( )
leukaemia ( )
Lymphoid leukemia ( )
UniProt ID
TLX3_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00046
Sequence
MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLP
ASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSL
GGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICE
LEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLM
LQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV
KEGG Pathway
Transcriptio.l misregulation in cancer (hsa05202 )

Molecular Interaction Atlas (MIA) of This DOT

16 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Adult T-cell leukemia/lymphoma DIS882XU Definitive Genetic Variation [1]
Hepatocellular carcinoma DIS0J828 Definitive Biomarker [2]
Acute leukaemia DISDQFDI Strong Genetic Variation [3]
Acute lymphocytic leukaemia DISPX75S Strong Genetic Variation [4]
Bladder cancer DISUHNM0 Strong Biomarker [5]
Central hypoventilation syndrome, congenital DISQRK53 Strong Biomarker [6]
Hirschsprung disease DISUUSM1 Strong Genetic Variation [7]
Leukemia DISNAKFL Strong Altered Expression [8]
Neoplasm DISZKGEW Strong Altered Expression [2]
T-cell leukaemia DISJ6YIF Strong Posttranslational Modification [9]
Urinary bladder cancer DISDV4T7 Strong Biomarker [5]
Urinary bladder neoplasm DIS7HACE Strong Biomarker [5]
Childhood acute lymphoblastic leukemia DISJ5D6U Limited Posttranslational Modification [9]
Chromosomal disorder DISM5BB5 Limited Genetic Variation [4]
leukaemia DISS7D1V Limited Altered Expression [8]
Lymphoid leukemia DIS65TYQ Limited Genetic Variation [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 16 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Doxorubicin DMVP5YE Approved Doxorubicin increases the expression of T-cell leukemia homeobox protein 3 (TLX3). [10]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of T-cell leukemia homeobox protein 3 (TLX3). [11]
------------------------------------------------------------------------------------

References

1 Immunophenotyping with CD135 and CD117 predicts the FLT3, IL-7R and TLX3 gene mutations in childhood T-cell acute leukemia.Blood Cells Mol Dis. 2016 Mar;57:74-80. doi: 10.1016/j.bcmd.2015.12.003. Epub 2015 Dec 2.
2 TLX3 repressed SNAI1-induced epithelial-mesenchymal transition by directly constraining STAT3 phosphorylation and functionally sensitized 5-FU chemotherapy in hepatocellular carcinoma.Int J Biol Sci. 2019 Jun 5;15(8):1696-1711. doi: 10.7150/ijbs.33844. eCollection 2019.
3 Successful treatment of a child with T/myeloid acute bilineal leukemia associated with TLX3/BCL11B fusion and 9q deletion.Pediatr Blood Cancer. 2011 Mar;56(3):467-9. doi: 10.1002/pbc.22850. Epub 2010 Nov 11.
4 Simultaneous translocation of both TCR Loci (14q11) with rare partner loci (Xq22 and 12p13) in a case of T-lymphoblastic leukemia.Ann Lab Med. 2012 May;32(3):220-4. doi: 10.3343/alm.2012.32.3.220. Epub 2012 Apr 18.
5 Aberrant DNA methylation of T-cell leukemia, homeobox 3 modulates cisplatin sensitivity in bladder cancer.Int J Oncol. 2011 Sep;39(3):727-33. doi: 10.3892/ijo.2011.1049. Epub 2011 May 23.
6 Exclusion of RNX as a major gene in congenital central hypoventilation syndrome (CCHS, Ondine's curse).Am J Med Genet A. 2003 Feb 15;117A(1):18-20. doi: 10.1002/ajmg.a.10934.
7 Mutational analysis of the RNX gene in congenital central hypoventilation syndrome.Am J Med Genet. 2002 Nov 22;113(2):178-82. doi: 10.1002/ajmg.10746.
8 PHF6 regulates hematopoietic stem and progenitor cells and its loss synergizes with expression of TLX3 to cause leukemia.Blood. 2019 Apr 18;133(16):1729-1741. doi: 10.1182/blood-2018-07-860726. Epub 2019 Feb 12.
9 Validation of DNA methylation biomarkers for diagnosis of acute lymphoblastic leukemia.Clin Chem. 2014 Jul;60(7):995-1003. doi: 10.1373/clinchem.2013.219956. Epub 2014 May 14.
10 Gamma-irradiation and doxorubicin treatment of normal human cells cause cell cycle arrest via different pathways. Mol Cells. 2005 Dec 31;20(3):331-8.
11 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.