Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTBXTCN5)

DOT Name Neuroguidin (NGDN)
Synonyms Centromere accumulated nuclear protein 1; CANu1; EIF4E-binding protein
Gene Name NGDN
Related Disease
Bone osteosarcoma ( )
Colonic neoplasm ( )
Cytomegalovirus infection ( )
Huntington disease ( )
Osteosarcoma ( )
Breast cancer ( )
Breast carcinoma ( )
Hyperglycemia ( )
MALT lymphoma ( )
UniProt ID
NGDN_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
7MQ8
Pfam ID
PF04000
Sequence
MAALGVLESDLPSAVTLLKNLQEQVMAVTAQVKSLTQKVQAGAYPTEKGLSFLEVKDQLL
LMYLMDLTHLILDKASGGSLQGHDAVLRLVEIRTVLEKLRPLDQKLKYQIDKLIKTAVTG
SLSENDPLRFKPHPSNMMSKLSSEDEEEDEAEDDQSEASGKKSVKGVSKKYVPPRLVPVH
YDETEAEREKKRLERAKRRALSSSVIRELKEQYSDAPEEIRDARHPHVTRQSQEDQHRIN
YEESMMVRLSVSKREKGRRKRANVMSSQLHSLTHFSDISALTGGTVHLDEDQNPIKKRKK
IPQKGRKKKGFRRRR
Function
Part of the small subunit (SSU) processome, first precursor of the small eukaryotic ribosomal subunit. During the assembly of the SSU processome in the nucleolus, many ribosome biogenesis factors, an RNA chaperone and ribosomal proteins associate with the nascent pre-rRNA and work in concert to generate RNA folding, modifications, rearrangements and cleavage as well as targeted degradation of pre-ribosomal RNA by the RNA exosome. Its dissociation from the complex determines the transition from state pre-A1 to state pre-A1*. Inhibits mRNA translation in a cytoplasmic polyadenylation element (CPE)-dependent manner.

Molecular Interaction Atlas (MIA) of This DOT

9 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Bone osteosarcoma DIST1004 Strong Biomarker [1]
Colonic neoplasm DISSZ04P Strong Genetic Variation [2]
Cytomegalovirus infection DISCEMGC Strong Biomarker [3]
Huntington disease DISQPLA4 Strong Biomarker [4]
Osteosarcoma DISLQ7E2 Strong Biomarker [1]
Breast cancer DIS7DPX1 moderate Altered Expression [5]
Breast carcinoma DIS2UE88 moderate Altered Expression [5]
Hyperglycemia DIS0BZB5 Limited Altered Expression [6]
MALT lymphoma DIS1AVVE Limited Biomarker [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 9 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
7 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate affects the expression of Neuroguidin (NGDN). [8]
Cupric Sulfate DMP0NFQ Approved Cupric Sulfate increases the expression of Neuroguidin (NGDN). [9]
Marinol DM70IK5 Approved Marinol decreases the expression of Neuroguidin (NGDN). [11]
(+)-JQ1 DM1CZSJ Phase 1 (+)-JQ1 decreases the expression of Neuroguidin (NGDN). [13]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Neuroguidin (NGDN). [14]
Bisphenol A DM2ZLD7 Investigative Bisphenol A decreases the expression of Neuroguidin (NGDN). [16]
Formaldehyde DM7Q6M0 Investigative Formaldehyde increases the expression of Neuroguidin (NGDN). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Drug(s)
4 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Arsenic DMTL2Y1 Approved Arsenic affects the methylation of Neuroguidin (NGDN). [10]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Neuroguidin (NGDN). [12]
PMID28870136-Compound-52 DMFDERP Patented PMID28870136-Compound-52 decreases the phosphorylation of Neuroguidin (NGDN). [15]
Coumarin DM0N8ZM Investigative Coumarin increases the phosphorylation of Neuroguidin (NGDN). [15]
------------------------------------------------------------------------------------

References

1 Depletion of Neuroguidin/CANu1 sensitizes human osteosarcoma U2OS cells to doxorubicin.BMB Rep. 2011 Jan;44(1):46-51. doi: 10.5483/BMBRep.2011.44.1.46.
2 CANu1, a novel nucleolar protein, accumulated on centromere in response to DNA damage.Genes Cells. 2008 Aug;13(8):787-96. doi: 10.1111/j.1365-2443.2008.01205.x. Epub 2008 Jun 28.
3 Human cytomegalovirus infection alters the substrate specificities and rapamycin sensitivities of raptor- and rictor-containing complexes.Proc Natl Acad Sci U S A. 2006 Sep 19;103(38):14182-7. doi: 10.1073/pnas.0605825103. Epub 2006 Sep 7.
4 Increased translation as a novel pathogenic mechanism in Huntington's disease.Brain. 2019 Oct 1;142(10):3158-3175. doi: 10.1093/brain/awz230.
5 Aberrations in translational regulation are associated with poor prognosis in hormone receptor-positive breast cancer.Breast Cancer Res. 2012 Oct 26;14(5):R138. doi: 10.1186/bcr3343.
6 Ablation of 4E-BP1/2 prevents hyperglycemia-mediated induction of VEGF expression in the rodent retina and in Muller cells in culture.Diabetes. 2010 Sep;59(9):2107-16. doi: 10.2337/db10-0148. Epub 2010 Jun 14.
7 High prevalence of Chlamydophila psittaci subclinical infection in Italian patients with Sjgren's syndrome and parotid gland marginal zone B-cell lymphoma of MALT-type.Clin Exp Rheumatol. 2014 Jan-Feb;32(1):61-5. Epub 2014 Jan 20.
8 Gene Expression Regulation and Pathway Analysis After Valproic Acid and Carbamazepine Exposure in a Human Embryonic Stem Cell-Based Neurodevelopmental Toxicity Assay. Toxicol Sci. 2015 Aug;146(2):311-20. doi: 10.1093/toxsci/kfv094. Epub 2015 May 15.
9 Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
10 Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
11 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Inhibition of BRD4 attenuates tumor cell self-renewal and suppresses stem cell signaling in MYC driven medulloblastoma. Oncotarget. 2014 May 15;5(9):2355-71.
14 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
15 Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
16 Bisphenol A induces DSB-ATM-p53 signaling leading to cell cycle arrest, senescence, autophagy, stress response, and estrogen release in human fetal lung fibroblasts. Arch Toxicol. 2018 Apr;92(4):1453-1469.
17 Gene expression changes in primary human nasal epithelial cells exposed to formaldehyde in vitro. Toxicol Lett. 2010 Oct 5;198(2):289-95.