| DOT Name |
DNA-directed RNA polymerases I, II, and III subunit RPABC2 (POLR2F)
|
| Synonyms |
RNA polymerases I, II, and III subunit ABC2; DNA-directed RNA polymerase II subunit F; DNA-directed RNA polymerases I, II, and III 14.4 kDa polypeptide; RPABC14.4; RPB14.4; RPB6 homolog; RPC15 |
| Gene Name |
POLR2F
|
| Related Disease |
- Glioblastoma multiforme ( )
- Advanced cancer ( )
- Carcinoma ( )
- Colorectal carcinoma ( )
- Colorectal neoplasm ( )
- Waardenburg syndrome type 2A ( )
|
| UniProt ID |
|
| 3D Structure |
|
| PDB ID |
1QKL ; 5IY6 ; 5IY7 ; 5IY8 ; 5IY9 ; 5IYA ; 5IYB ; 5IYC ; 5IYD ; 6DRD ; 6O9L ; 6XRE ; 7A6H ; 7AE1 ; 7AE3 ; 7AEA ; 7AST ; 7D58 ; 7D59 ; 7DN3 ; 7DTH ; 7DTI ; 7DU2 ; 7FJI ; 7FJJ ; 7LBM ; 7OB9 ; 7OBA ; 7OBB ; 7VBA ; 7VBB ; 7VBC ; 8A43 ; 8ITY ; 8IUE ; 8IUH
|
| Pfam ID |
|
| Sequence |
MSDNEDNFDGDDFDDVEEDEGLDDLENAEEEGQENVEILPSGERPQANQKRITTPYMTKY
ERARVLGTRALQIAMCAPVMVELEGETDPLLIAMKELKARKIPIIIRRYLPDGSYEDWGV
DELIITD
|
| Function |
DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common component of RNA polymerases I, II, and III which synthesize ribosomal RNA precursors, mRNA precursors and many functional non-coding RNAs, and small RNAs, such as 5S rRNA and tRNAs, respectively. Pol II is the central component of the basal RNA polymerase II transcription machinery. Pols are composed of mobile elements that move relative to each other. In Pol II, POLR2F/RPABC2 is part of the clamp element and together with parts of POLR2A/RPB1 and POLR2B/RPB2 forms a pocket to which the POLR2D/RPB4-POLR2G/RPB7 subcomplex binds.
|
| KEGG Pathway |
- R. polymerase (hsa03020 )
- Nucleotide excision repair (hsa03420 )
- Cytosolic D.-sensing pathway (hsa04623 )
- Huntington disease (hsa05016 )
|
| Reactome Pathway |
- Formation of the Early Elongation Complex (R-HSA-113418 )
- Formation of HIV elongation complex in the absence of HIV Tat (R-HSA-167152 )
- Formation of the HIV-1 Early Elongation Complex (R-HSA-167158 )
- RNA Pol II CTD phosphorylation and interaction with CE during HIV infection (R-HSA-167160 )
- HIV Transcription Initiation (R-HSA-167161 )
- RNA Polymerase II HIV Promoter Escape (R-HSA-167162 )
- Transcription of the HIV genome (R-HSA-167172 )
- Formation of HIV-1 elongation complex containing HIV-1 Tat (R-HSA-167200 )
- Pausing and recovery of Tat-mediated HIV elongation (R-HSA-167238 )
- Abortive elongation of HIV-1 transcript in the absence of Tat (R-HSA-167242 )
- Tat-mediated HIV elongation arrest and recovery (R-HSA-167243 )
- Tat-mediated elongation of the HIV-1 transcript (R-HSA-167246 )
- HIV elongation arrest and recovery (R-HSA-167287 )
- Pausing and recovery of HIV elongation (R-HSA-167290 )
- Viral Messenger RNA Synthesis (R-HSA-168325 )
- Cytosolic sensors of pathogen-associated DNA (R-HSA-1834949 )
- MicroRNA (miRNA) biogenesis (R-HSA-203927 )
- NoRC negatively regulates rRNA expression (R-HSA-427413 )
- B-WICH complex positively regulates rRNA expression (R-HSA-5250924 )
- Transcriptional regulation by small RNAs (R-HSA-5578749 )
- PIWI-interacting RNA (piRNA) biogenesis (R-HSA-5601884 )
- Activation of anterior HOX genes in hindbrain development during early embryogenesis (R-HSA-5617472 )
- RNA Polymerase II Pre-transcription Events (R-HSA-674695 )
- Formation of TC-NER Pre-Incision Complex (R-HSA-6781823 )
- Transcription-Coupled Nucleotide Excision Repair (TC-NER) (R-HSA-6781827 )
- Dual incision in TC-NER (R-HSA-6782135 )
- Gap-filling DNA repair synthesis and ligation in TC-NER (R-HSA-6782210 )
- TP53 Regulates Transcription of DNA Repair Genes (R-HSA-6796648 )
- FGFR2 alternative splicing (R-HSA-6803529 )
- RNA polymerase II transcribes snRNA genes (R-HSA-6807505 )
- mRNA Capping (R-HSA-72086 )
- mRNA Splicing - Major Pathway (R-HSA-72163 )
- mRNA Splicing - Minor Pathway (R-HSA-72165 )
- Processing of Capped Intron-Containing Pre-mRNA (R-HSA-72203 )
- RNA Polymerase I Transcription Initiation (R-HSA-73762 )
- RNA Polymerase I Promoter Escape (R-HSA-73772 )
- RNA Polymerase II Promoter Escape (R-HSA-73776 )
- RNA Polymerase II Transcription Pre-Initiation And Promoter Opening (R-HSA-73779 )
- RNA Polymerase III Chain Elongation (R-HSA-73780 )
- RNA Polymerase I Transcription Termination (R-HSA-73863 )
- RNA Polymerase III Transcription Termination (R-HSA-73980 )
- RNA Polymerase III Abortive And Retractive Initiation (R-HSA-749476 )
- RNA Polymerase II Transcription Initiation (R-HSA-75953 )
- RNA Polymerase II Transcription Elongation (R-HSA-75955 )
- RNA Polymerase II Transcription Initiation And Promoter Clearance (R-HSA-76042 )
- RNA Polymerase III Transcription Initiation From Type 1 Promoter (R-HSA-76061 )
- RNA Polymerase III Transcription Initiation From Type 2 Promoter (R-HSA-76066 )
- RNA Polymerase III Transcription Initiation From Type 3 Promoter (R-HSA-76071 )
- RNA Pol II CTD phosphorylation and interaction with CE (R-HSA-77075 )
- Signaling by FGFR2 IIIa TM (R-HSA-8851708 )
- Estrogen-dependent gene expression (R-HSA-9018519 )
- Inhibition of DNA recombination at telomere (R-HSA-9670095 )
- Formation of RNA Pol II elongation complex (R-HSA-112382 )
|
|
|
|
|
|
|
