General Information of Drug Off-Target (DOT) (ID: OTFFF738)

DOT Name Chymotrypsinogen B (CTRB1)
Synonyms EC 3.4.21.1
Gene Name CTRB1
Related Disease
Age-related macular degeneration ( )
Coronary atherosclerosis ( )
Coronary heart disease ( )
Non-insulin dependent diabetes ( )
Chronic pancreatitis ( )
Neoplasm ( )
Pancreatitis ( )
UniProt ID
CTRB1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.21.1
Pfam ID
PF00089
Sequence
MASLWLLSCFSLVGAAFGCGVPAIHPVLSGLSRIVNGEDAVPGSWPWQVSLQDKTGFHFC
GGSLISEDWVVTAAHCGVRTSDVVVAGEFDQGSDEENIQVLKIAKVFKNPKFSILTVNND
ITLLKLATPARFSQTVSAVCLPSADDDFPAGTLCATTGWGKTKYNANKTPDKLQQAALPL
LSNAECKKSWGRRITDVMICAGASGVSSCMGDSGGPLVCQKDGAWTLVGIVSWGSDTCST
SSPGVYARVTKLIPWVQKILAAN
KEGG Pathway
Pancreatic secretion (hsa04972 )
Protein digestion and absorption (hsa04974 )
Reactome Pathway
Uptake of dietary cobalamins into enterocytes (R-HSA-9758881 )
Activation of Matrix Metalloproteinases (R-HSA-1592389 )

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Age-related macular degeneration DIS0XS2C Strong Biomarker [1]
Coronary atherosclerosis DISKNDYU Strong Genetic Variation [2]
Coronary heart disease DIS5OIP1 Strong Genetic Variation [2]
Non-insulin dependent diabetes DISK1O5Z Strong Biomarker [3]
Chronic pancreatitis DISBUOMJ Limited Genetic Variation [4]
Neoplasm DISZKGEW Limited Genetic Variation [5]
Pancreatitis DIS0IJEF Limited Genetic Variation [4]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Chymotrypsinogen B (CTRB1). [6]
------------------------------------------------------------------------------------
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the expression of Chymotrypsinogen B (CTRB1). [7]
Bisphenol A DM2ZLD7 Investigative Bisphenol A increases the expression of Chymotrypsinogen B (CTRB1). [8]
------------------------------------------------------------------------------------

References

1 Genome-wide analysis of disease progression in age-related macular degeneration.Hum Mol Genet. 2018 Mar 1;27(5):929-940. doi: 10.1093/hmg/ddy002.
2 Genetic overlap between birthweight and adult cardiometabolic diseases has implications for genomic medicine.Sci Rep. 2019 Mar 11;9(1):4076. doi: 10.1038/s41598-019-40834-w.
3 Functional and association analysis of an Amerindian-derived population-specific p.(Thr280Met) variant in RBPJL, a component of the PTF1 complex.Eur J Hum Genet. 2018 Feb;26(2):238-246. doi: 10.1038/s41431-017-0062-6. Epub 2018 Jan 4.
4 Genome-wide association study identifies inversion in the CTRB1-CTRB2 locus to modify risk for alcoholic and non-alcoholic chronic pancreatitis.Gut. 2018 Oct;67(10):1855-1863. doi: 10.1136/gutjnl-2017-314454. Epub 2017 Jul 28.
5 Allele loss on chromosome 16 associated with progression of human hepatocellular carcinoma.Proc Natl Acad Sci U S A. 1990 Sep;87(17):6791-4. doi: 10.1073/pnas.87.17.6791.
6 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
7 Benzo[a]pyrene-induced changes in microRNA-mRNA networks. Chem Res Toxicol. 2012 Apr 16;25(4):838-49.
8 Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.