Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFPJEC1)

• DOT Name: AMMECR1-like protein (AMMECR1L)
• Gene Name: AMMECR1L
• UniProt ID: AMERL_HUMAN
• Pfam ID: PF01871
• Sequence:
  MGKRRCVPPLEPKLAAGCCGVKKPKLSGSGTHSHGNQSTTVPGSSSGPLQNHQHVDSSSG
  RENVSDLTLGPGNSPITRMNPASGALSPLPRPNGTANTTKNLVVTAEMCCYCFDVLYCHL
  YGFPQPRLPRFTNDPYPLFVTWKTGRDKRLRGCIGTFSAMNLHSGLREYTLTSALKDSRF
  PPLTREELPKLFCSVSLLTNFEDASDYLDWEVGVHGIRIEFINEKGVKRTATYLPEVAKE
  QDWDQIQTIDSLLRKGGFKAPITSEFRKTIKLTRYRSEKVTISYAEYIASRQHCFQNGTL
  HAPPLYNHYS

Molecular Interaction Atlas (MIA) of This DOT

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the methylation of AMMECR1-like protein (AMMECR1L).	[1]
PMID28870136-Compound-52	DMFDERP	Patented	PMID28870136-Compound-52 decreases the phosphorylation of AMMECR1-like protein (AMMECR1L).	[11]

11 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of AMMECR1-like protein (AMMECR1L).	[2]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of AMMECR1-like protein (AMMECR1L).	[3]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of AMMECR1-like protein (AMMECR1L).	[4]
Doxorubicin	DMVP5YE	Approved	Doxorubicin decreases the expression of AMMECR1-like protein (AMMECR1L).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate increases the expression of AMMECR1-like protein (AMMECR1L).	[6]
Hydrogen peroxide	DM1NG5W	Approved	Hydrogen peroxide affects the expression of AMMECR1-like protein (AMMECR1L).	[7]
Phenobarbital	DMXZOCG	Approved	Phenobarbital affects the expression of AMMECR1-like protein (AMMECR1L).	[8]
Melphalan	DMOLNHF	Approved	Melphalan increases the expression of AMMECR1-like protein (AMMECR1L).	[9]
Urethane	DM7NSI0	Phase 4	Urethane increases the expression of AMMECR1-like protein (AMMECR1L).	[10]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of AMMECR1-like protein (AMMECR1L).	[12]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of AMMECR1-like protein (AMMECR1L).	[13]

References

• [1] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [2] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [3] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [4] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [5] Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Minimal peroxide exposure of neuronal cells induces multifaceted adaptive responses. PLoS One. 2010 Dec 17;5(12):e14352. doi: 10.1371/journal.pone.0014352.
• [8] Reproducible chemical-induced changes in gene expression profiles in human hepatoma HepaRG cells under various experimental conditions. Toxicol In Vitro. 2009 Apr;23(3):466-75. doi: 10.1016/j.tiv.2008.12.018. Epub 2008 Dec 30.
• [9] Bone marrow osteoblast damage by chemotherapeutic agents. PLoS One. 2012;7(2):e30758. doi: 10.1371/journal.pone.0030758. Epub 2012 Feb 17.
• [10] Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
• [11] Quantitative phosphoproteomics reveal cellular responses from caffeine, coumarin and quercetin in treated HepG2 cells. Toxicol Appl Pharmacol. 2022 Aug 15;449:116110. doi: 10.1016/j.taap.2022.116110. Epub 2022 Jun 7.
• [12] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.
• [13] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.