Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTFSNRXK)

DOT Name Protocadherin-20 (PCDH20)
Synonyms Protocadherin-13
Gene Name PCDH20
Related Disease
Lung cancer ( )
Non-small-cell lung cancer ( )
Hepatocellular carcinoma ( )
Hypopharyngeal squamous cell carcinoma ( )
Neoplasm ( )
Carcinoma of liver and intrahepatic biliary tract ( )
Liver cancer ( )
UniProt ID
PCD20_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00028
Sequence
MRGRGNARSSQALGVSWCPATWHPRLDMGRLHRPRSSTSYRNLPHLFLFFLFVGPFSCLG
SYSRATELLYSLNEGLPAGVLIGSLAEDLRLLPRSAGRPDPQSQLPERTGAEWNPPLSFS
LASRGLSGQYVTLDNRSGELHTSAQEIDREALCVEGGGGTAWSGSVSISSSPSDSCLLLL
DVLVLPQEYFRFVKVKIAIRDINDNAPQFPVSQISVWVPENAPVNTRLAIEHPAVDPDVG
INGVQTYRLLDYHGMFTLDVEENENGERTPYLIVMGALDRETQDQYVSIIIAEDGGSPPL
LGSATLTIGISDINDNCPLFTDSQINVTVYGNATVGTPIAAVQAVDKDLGTNAQITYSYS
QKVPQASKDLFHLDENTGVIKLFSKIGGSVLESHKLTILANGPGCIPAVITALVSIIKVI
FRPPEIVPRYIANEIDGVVYLKELEPVNTPIAFFTIRDPEGKYKVNCYLDGEGPFRLSPY
KPYNNEYLLETTKPMDYELQQFYEVAVVAWNSEGFHVKRVIKVQLLDDNDNAPIFLQPLI
ELTIEENNSPNAFLTKLYATDADSEERGQVSYFLGPDAPSYFSLDSVTGILTVSTQLDRE
EKEKYRYTVRAVDCGKPPRESVATVALTVLDKNDNSPRFINKDFSFFVPENFPGYGEIGV
ISVTDADAGRNGWVALSVVNQSDIFVIDTGKGMLRAKVSLDREQQSSYTLWVEAVDGGEP
ALSSTAKITILLLDINDNPPLVLFPQSNMSYLLVLPSTLPGSPVTEVYAVDKDTGMNAVI
AYSIIGRRGPRPESFRIDPKTGNITLEEALLQTDYGLHRLLVKVSDHGYPEPLHSTVMVN
LFVNDTVSNESYIESLLRKEPEINIEEKEPQISIEPTHRKVESVSCMPTLVALSVISLGS
ITLVTGMGIYICLRKGEKHPREDENLEVQIPLKGKIDLHMRERKPMDISNI
Function Potential calcium-dependent cell-adhesion protein.

Molecular Interaction Atlas (MIA) of This DOT

7 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Lung cancer DISCM4YA Definitive Posttranslational Modification [1]
Non-small-cell lung cancer DIS5Y6R9 Definitive Genetic Variation [1]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [2]
Hypopharyngeal squamous cell carcinoma DISDDD65 Strong Altered Expression [3]
Neoplasm DISZKGEW Strong Biomarker [3]
Carcinoma of liver and intrahepatic biliary tract DIS8WA0W moderate Altered Expression [2]
Liver cancer DISDE4BI moderate Altered Expression [2]
------------------------------------------------------------------------------------
⏷ Show the Full List of 7 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
14 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the expression of Protocadherin-20 (PCDH20). [4]
Ciclosporin DMAZJFX Approved Ciclosporin decreases the expression of Protocadherin-20 (PCDH20). [5]
Tretinoin DM49DUI Approved Tretinoin increases the expression of Protocadherin-20 (PCDH20). [6]
Doxorubicin DMVP5YE Approved Doxorubicin decreases the expression of Protocadherin-20 (PCDH20). [7]
Temozolomide DMKECZD Approved Temozolomide increases the expression of Protocadherin-20 (PCDH20). [8]
Arsenic trioxide DM61TA4 Approved Arsenic trioxide decreases the expression of Protocadherin-20 (PCDH20). [9]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Protocadherin-20 (PCDH20). [10]
Marinol DM70IK5 Approved Marinol decreases the expression of Protocadherin-20 (PCDH20). [11]
Zoledronate DMIXC7G Approved Zoledronate decreases the expression of Protocadherin-20 (PCDH20). [12]
Panobinostat DM58WKG Approved Panobinostat increases the expression of Protocadherin-20 (PCDH20). [13]
Niclosamide DMJAGXQ Approved Niclosamide decreases the expression of Protocadherin-20 (PCDH20). [14]
Cytarabine DMZD5QR Approved Cytarabine decreases the expression of Protocadherin-20 (PCDH20). [15]
SNDX-275 DMH7W9X Phase 3 SNDX-275 increases the expression of Protocadherin-20 (PCDH20). [13]
Trichostatin A DM9C8NX Investigative Trichostatin A increases the expression of Protocadherin-20 (PCDH20). [17]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Drug(s)
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Protocadherin-20 (PCDH20). [16]
------------------------------------------------------------------------------------

References

1 Frequent silencing of the candidate tumor suppressor PCDH20 by epigenetic mechanism in non-small-cell lung cancers.Cancer Res. 2006 May 1;66(9):4617-26. doi: 10.1158/0008-5472.CAN-05-4437.
2 Decreased expression of protocadherin 20 is associated with poor prognosis in hepatocellular carcinoma.Oncotarget. 2017 Jan 10;8(2):3018-3028. doi: 10.18632/oncotarget.13822.
3 PCDH20acts as a tumour-suppressor gene through the Wnt/-catenin signalling pathway in hypopharyngeal squamous cell carcinoma.Cancer Biomark. 2019;26(2):209-217. doi: 10.3233/CBM-190442.
4 The neuroprotective action of the mood stabilizing drugs lithium chloride and sodium valproate is mediated through the up-regulation of the homeodomain protein Six1. Toxicol Appl Pharmacol. 2009 Feb 15;235(1):124-34.
5 Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
6 Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
7 Bringing in vitro analysis closer to in vivo: studying doxorubicin toxicity and associated mechanisms in 3D human microtissues with PBPK-based dose modelling. Toxicol Lett. 2018 Sep 15;294:184-192.
8 Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
9 Identification of transcriptome signatures and biomarkers specific for potential developmental toxicants inhibiting human neural crest cell migration. Arch Toxicol. 2016 Jan;90(1):159-80.
10 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
11 THC exposure of human iPSC neurons impacts genes associated with neuropsychiatric disorders. Transl Psychiatry. 2018 Apr 25;8(1):89. doi: 10.1038/s41398-018-0137-3.
12 Interleukin-19 as a translational indicator of renal injury. Arch Toxicol. 2015 Jan;89(1):101-6.
13 A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
14 Mitochondrial Uncoupling Induces Epigenome Remodeling and Promotes Differentiation in Neuroblastoma. Cancer Res. 2023 Jan 18;83(2):181-194. doi: 10.1158/0008-5472.CAN-22-1029.
15 Cytosine arabinoside induces ectoderm and inhibits mesoderm expression in human embryonic stem cells during multilineage differentiation. Br J Pharmacol. 2011 Apr;162(8):1743-56.
16 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
17 From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.