Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTG0X9UQ)

DOT Name Arylsulfatase H (ARSH)
Synonyms ASH; EC 3.1.6.-
Gene Name ARSH
Related Disease
Alcoholic cirrhosis of liver ( )
Chondrodysplasia punctata ( )
Dermatitis ( )
Dyschromatosis symmetrica hereditaria ( )
HIV infectious disease ( )
Liver cirrhosis ( )
Matthew-Wood syndrome ( )
Mucopolysaccharidosis ( )
Mucopolysaccharidosis II ( )
Mucosulfatidosis ( )
Myelodysplastic syndrome ( )
Myocardial disease ( )
Oculocerebrorenal syndrome ( )
Sexually transmitted infection ( )
Ventricular septal defect ( )
Advanced cancer ( )
Neuroblastoma ( )
Hepatitis ( )
leukaemia ( )
Leukemia ( )
Non-alcoholic steatohepatitis ( )
Small lymphocytic lymphoma ( )
UniProt ID
ARSH_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.1.6.-
Pfam ID
PF00884 ; PF14707
Sequence
MTRNARPNIVLLMADDLGVGDLCCYGNNSVSTPNIDRLASEGVRLTQHLAAASMCTPSRA
AFLTGRYPIRSGMVSAYNLNRAFTWLGGSGGLPTNETTFAKLLQHRGYRTGLIGKWHLGL
SCASRNDHCYHPLNHGFHYFYGVPFGLLSDCQASKTPELHRWLRIKLWISTVALALVPFL
LLIPKFARWFSVPWKVIFVFALLAFLFFTSWYSSYGFTRRWNCILMRNHEIIQQPMKEEK
VASLMLKEALAFIERYKREPFLLFFSFLHVHTPLISKKKFVGRSKYGRYGDNVEEMDWMV
GKILDALDQERLANHTLVYFTSDNGGHLEPLDGAVQLGGWNGIYKGGKGMGGWEGGIRVP
GIFRWPSVLEAGRVINEPTSLMDIYPTLSYIGGGILSQDRVIDGQNLMPLLEGRASHSDH
EFLFHYCGVYLHTVRWHQKDCATVWKAHYVTPKFYPEGTGACYGSGICSCSGDVTYHDPP
LLFDISRDPSEALPLNPDNEPLFDSVIKKMEAAIREHRRTLTPVPQQFSVFNTIWKPWLQ
PCCGTFPFCGCDKEDDILPMAP
Reactome Pathway
Glycosphingolipid catabolism (R-HSA-9840310 )
The activation of arylsulfatases (R-HSA-1663150 )

Molecular Interaction Atlas (MIA) of This DOT

22 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Alcoholic cirrhosis of liver DISQ1WRT Strong Biomarker [1]
Chondrodysplasia punctata DISERVGO Strong Genetic Variation [2]
Dermatitis DISY5SZC Strong Biomarker [3]
Dyschromatosis symmetrica hereditaria DIS9HI9T Strong Biomarker [4]
HIV infectious disease DISO97HC Strong Genetic Variation [5]
Liver cirrhosis DIS4G1GX Strong Genetic Variation [1]
Matthew-Wood syndrome DISA7HR7 Strong Biomarker [6]
Mucopolysaccharidosis DISB083T Strong Biomarker [7]
Mucopolysaccharidosis II DIS87GLG Strong Genetic Variation [8]
Mucosulfatidosis DISWOTAK Strong Altered Expression [9]
Myelodysplastic syndrome DISYHNUI Strong Biomarker [10]
Myocardial disease DISRYD6K Strong Biomarker [11]
Oculocerebrorenal syndrome DIS8TEDY Strong Genetic Variation [12]
Sexually transmitted infection DISIVIAL Strong Biomarker [4]
Ventricular septal defect DISICO41 Strong Biomarker [11]
Advanced cancer DISAT1Z9 moderate Biomarker [13]
Neuroblastoma DISVZBI4 moderate Biomarker [13]
Hepatitis DISXXX35 Limited Biomarker [14]
leukaemia DISS7D1V Limited Biomarker [15]
Leukemia DISNAKFL Limited Biomarker [15]
Non-alcoholic steatohepatitis DIST4788 Limited Genetic Variation [14]
Small lymphocytic lymphoma DIS30POX Limited Biomarker [16]
------------------------------------------------------------------------------------
⏷ Show the Full List of 22 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene decreases the methylation of Arylsulfatase H (ARSH). [17]
------------------------------------------------------------------------------------

References

1 Diagnosis and Treatment of Alcohol-Associated Liver Diseases: 2019 Practice Guidance From the American Association for the Study of Liver Diseases.Hepatology. 2020 Jan;71(1):306-333. doi: 10.1002/hep.30866.
2 A cluster of sulfatase genes on Xp22.3: mutations in chondrodysplasia punctata (CDPX) and implications for warfarin embryopathy. Cell. 1995 Apr 7;81(1):15-25. doi: 10.1016/0092-8674(95)90367-4.
3 Ashwagandha root extract exerts antiinflammatory effects in HaCaT cells by inhibiting the MAPK/NFB pathways and by regulating cytokines.Int J Mol Med. 2018 Jul;42(1):425-434. doi: 10.3892/ijmm.2018.3608. Epub 2018 Apr 2.
4 Randomized pilot trial of a cognitive-behavioral alcohol, self-harm, and HIV prevention program for teens in mental health treatment.Behav Res Ther. 2017 Feb;89:49-56. doi: 10.1016/j.brat.2016.11.005. Epub 2016 Nov 12.
5 PNPLA3 Gene Polymorphisms in HCV/HIV-Coinfected Individuals.Dig Dis Sci. 2018 Nov;63(11):2969-2974. doi: 10.1007/s10620-018-5278-y. Epub 2018 Sep 14.
6 Alcoholic and non-alcoholic steatohepatitis: global perspective and emerging science.J Gastroenterol. 2019 Mar;54(3):218-225. doi: 10.1007/s00535-018-01542-w. Epub 2019 Jan 14.
7 Bio-Plex immunoassay measuring the quantity of lysosomal N-acetylgalactosamine-6-sulfatase protein in dried blood spots for the screening of mucopolysaccharidosis IVA in newborn: a pilot study.BMJ Open. 2017 Jul 13;7(7):e014410. doi: 10.1136/bmjopen-2016-014410.
8 Molecular analysis in two siblings African patients with severe form of Hunter Syndrome: identification of a novel (p.Y54X) nonsense mutation.J Trop Pediatr. 2007 Dec;53(6):434-7. doi: 10.1093/tropej/fmm056. Epub 2007 Jul 5.
9 Expert recommendations for the laboratory diagnosis of MPS VI.Mol Genet Metab. 2012 May;106(1):73-82. doi: 10.1016/j.ymgme.2012.02.005. Epub 2012 Feb 10.
10 Meeting report: myelodysplastic syndromes at ASH 2007.Leukemia. 2008 May;22(5):893-7. doi: 10.1038/leu.2008.45. Epub 2008 Mar 6.
11 Congenital heart malformations associated with disproportionate ventricular septal thickening.Circulation. 1975 Nov;52(5):926-32. doi: 10.1161/01.cir.52.5.926.
12 Two closely related endocytic proteins that share a common OCRL-binding motif with APPL1.Proc Natl Acad Sci U S A. 2010 Feb 23;107(8):3511-6. doi: 10.1073/pnas.0914658107. Epub 2010 Feb 2.
13 Withania somnifera water extract as a potential candidate for differentiation based therapy of human neuroblastomas.PLoS One. 2013;8(1):e55316. doi: 10.1371/journal.pone.0055316. Epub 2013 Jan 31.
14 Digoxin Suppresses Pyruvate Kinase M2-Promoted HIF-1 Transactivation in Steatohepatitis.Cell Metab. 2018 Feb 6;27(2):339-350.e3. doi: 10.1016/j.cmet.2018.01.007.
15 Identification of Leukemia Subtypes from Microscopic Images Using Convolutional Neural Network.Diagnostics (Basel). 2019 Aug 25;9(3):104. doi: 10.3390/diagnostics9030104.
16 The future of chronic lymphocytic leukemia: potential directions from ASH 2017.Expert Rev Hematol. 2018 Jun;11(6):481-486. doi: 10.1080/17474086.2018.1480364. Epub 2018 Jun 6.
17 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.