Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGDMAAL)

• DOT Name: Protein TBATA (TBATA)
• Synonyms: Protein SPATIAL; Stromal protein associated with thymii and lymph node homolog; Thymus, brain and testes-associated protein
• Gene Name: TBATA
• Related Disease:
  Multiple sclerosis
  Acquired immune deficiency syndrome
  Cardiovascular disease
  Congenital toxoplasmosis
  HIV infectious disease
  Prostate cancer
  Prostate carcinoma
  Tuberculosis
  Uterine fibroids
  Breast cancer
  Breast carcinoma
• UniProt ID: TBATA_HUMAN
• Pfam ID: PF15256
• Sequence:
  MATDVQLADYPLMSPKAELKLEKKSGRKPRSPRDSGPQKELVIPGIVDFERIRRALRTPK
  PQTPGTYCFGRLSHHSFFSRHHPHPQHVTHIQDLTGKPVCVVRDFPAPLPESTVFSGCQM
  GIPTISVPIGDPQSNRNPQLSSEAWKKELKELASRVAFLTKEDELKKKEKEQKEEPLREQ
  GAKYSAETGRLIPASTRAVGRRRSHQGQQSQSSSRHEGVQAFLLQDQELLVLELLCRILE
  TDLLSAIQFWLLYAPPKEKDLALGLLQTAVAQLLPQPLVSIPTEKLLSQLPEVHEPPQEK
  QEPPCSQSPKKTKISPFTKSEKPEYIGEAQVLQMHSSQNTEKKTSKPRAES
• Function: May play a role in spermatid differentiation. Modulates thymic stromal cell proliferation and thymus function.

Molecular Interaction Atlas (MIA) of This DOT

11 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Multiple sclerosis	DISB2WZI	Definitive	Biomarker	[1]
Acquired immune deficiency syndrome	DISL5UOX	Strong	Genetic Variation	[2]
Cardiovascular disease	DIS2IQDX	Strong	Biomarker	[3]
Congenital toxoplasmosis	DISVP0XW	Strong	Genetic Variation	[4]
HIV infectious disease	DISO97HC	Strong	Genetic Variation	[2]
Prostate cancer	DISF190Y	Strong	Biomarker	[5]
Prostate carcinoma	DISMJPLE	Strong	Biomarker	[5]
Tuberculosis	DIS2YIMD	Strong	Genetic Variation	[6]
Uterine fibroids	DISBZRMJ	Strong	Genetic Variation	[7]
Breast cancer	DIS7DPX1	moderate	Biomarker	[8]
Breast carcinoma	DIS2UE88	moderate	Biomarker	[8]

2 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Protein TBATA (TBATA).	[9]
Rifampicin	DM5DSFZ	Approved	Rifampicin decreases the expression of Protein TBATA (TBATA).	[10]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Protein TBATA (TBATA).	[11]

References

• [1] Evidence for association of chromosome 10 open reading frame (C10orf27) gene polymorphisms and multiple sclerosis.Mult Scler. 2008 Apr;14(3):412-4. doi: 10.1177/1352458507083780. Epub 2008 Jan 21.
• [2] Spatial genetic structure of two HIV-I-resistant polymorphisms (CCR2-64 I and SDF1-3'A) alleles in population of Shandong Province, China.Biomed Environ Sci. 2005 Aug;18(4):241-53.
• [3] New progress in angiogenesis therapy of cardiovascular disease by ultrasound targeted microbubble destruction.Biomed Res Int. 2014;2014:872984. doi: 10.1155/2014/872984. Epub 2014 May 12.
• [4] The rural-urban effect on spatial genetic structure of type II Toxoplasma gondii strains involved in human congenital toxoplasmosis, France, 2002-2009.Infect Genet Evol. 2015 Dec;36:511-516. doi: 10.1016/j.meegid.2015.08.025. Epub 2015 Aug 22.
• [5] Assessment of the Utility of Gene Positioning Biomarkers in the Stratification of Prostate Cancers.Front Genet. 2019 Oct 17;10:1029. doi: 10.3389/fgene.2019.01029. eCollection 2019.
• [6] Epidemiological and spatial factors for tuberculosis: a matched case-control study in Nagata, Japan.Int J Tuberc Lung Dis. 2019 Feb 1;23(2):181-186. doi: 10.5588/ijtld.18.0369.
• [7] Spatial differences in biologic activity of large uterine leiomyomata.Fertil Steril. 2006 Jan;85(1):179-87. doi: 10.1016/j.fertnstert.2005.07.1294.
• [8] Ranked retrieval of segmented nuclei for objective assessment of cancer gene repositioning.BMC Bioinformatics. 2012 Sep 12;13:232. doi: 10.1186/1471-2105-13-232.
• [9] Retinoic acid receptor alpha amplifications and retinoic acid sensitivity in breast cancers. Clin Breast Cancer. 2013 Oct;13(5):401-8.
• [10] Integrated analysis of rifampicin-induced microRNA and gene expression changes in human hepatocytes. Drug Metab Pharmacokinet. 2014;29(4):333-40.
• [11] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.