Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGGJRO7)

• DOT Name: Protein FAM83F (FAM83F)
• Gene Name: FAM83F
• Related Disease:
  Esophageal squamous cell carcinoma
  Glioma
  Goiter
  Non-small-cell lung cancer
  Prostate cancer
  Prostate carcinoma
  Thyroid gland papillary carcinoma
  Neoplasm
• UniProt ID: FA83F_HUMAN
• Pfam ID: PF07894
• Sequence:
  MAESQLNCLDEAHVNEKVTEAQAAFYYCERRRAALEALLGGGEQAYRERLKEEQLRDFLS
  SPERQALRAAWSPYEDAVPAANARGKSKAKAKAPAPAPAESGESLAYWPDRSDTEVPPLD
  LGWTDTGFYRGVSRVTLFTHPPKDEKAPHLKQVVRQMIQQAQKVIAVVMDLFTDGDIFQD
  IVDAACKRRVPVYIILDEAGVKYFLEMCQDLQLTDFRIRNIRVRSVTGVGFYMPMGRIKG
  TLSSRFLMVDGDKVATGSYRFTWSSSHVDRNLLLLLTGQNVEPFDTEFRELYAISEEVDL
  YRQLSLAGRVGLHYSSTVARKLINPKYALVSGCRHPPGEMMRWAARQQREAGGNPEGQEE
  GASGGESAWRLESFLKDLVTVEQVLPPVEPIPLGELSQKDGRMVSHMHRDLKPKSREAPS
  RNGMGEAARGEAAPARRFSSRLFSRRAKRPAAPNGMASSVSTETSEVEFLTGKRPNENSS
  ADISGKTSPSSAKPSNCVIS

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Esophageal squamous cell carcinoma	DIS5N2GV	Strong	Altered Expression	[1]
Glioma	DIS5RPEH	Strong	Altered Expression	[2]
Goiter	DISLCGI6	Strong	Biomarker	[3]
Non-small-cell lung cancer	DIS5Y6R9	Strong	Altered Expression	[4]
Prostate cancer	DISF190Y	Strong	Genetic Variation	[5]
Prostate carcinoma	DISMJPLE	Strong	Genetic Variation	[5]
Thyroid gland papillary carcinoma	DIS48YMM	Strong	Biomarker	[3]
Neoplasm	DISZKGEW	moderate	Altered Expression	[6]

2 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Protein FAM83F (FAM83F).	[7]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Protein FAM83F (FAM83F).	[10]

3 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Protein FAM83F (FAM83F).	[8]
Nicotine	DMWX5CO	Approved	Nicotine increases the expression of Protein FAM83F (FAM83F).	[9]
Milchsaure	DM462BT	Investigative	Milchsaure increases the expression of Protein FAM83F (FAM83F).	[11]

References

• [1] MiR-455-3p acts as a prognostic marker and inhibits the proliferation and invasion of esophageal squamous cell carcinoma by targeting FAM83F.Eur Rev Med Pharmacol Sci. 2017 Jul;21(14):3200-3206.
• [2] MiR-650 inhibits the progression of glioma by targeting FAM83F.Eur Rev Med Pharmacol Sci. 2018 Dec;22(23):8391-8398. doi: 10.26355/eurrev_201812_16537.
• [3] The Highly Expressed FAM83F Protein in Papillary Thyroid Cancer Exerts a Pro-Oncogenic Role in Thyroid Follicular Cells.Front Endocrinol (Lausanne). 2019 Mar 1;10:134. doi: 10.3389/fendo.2019.00134. eCollection 2019.
• [4] MiR-940 inhibits the progression of NSCLC by targeting FAM83F.Eur Rev Med Pharmacol Sci. 2018 Sep;22(18):5964-5971. doi: 10.26355/eurrev_201809_15927.
• [5] A meta-analysis of genome-wide association studies to identify prostate cancer susceptibility loci associated with aggressive and non-aggressive disease.Hum Mol Genet. 2013 Jan 15;22(2):408-15. doi: 10.1093/hmg/dds425. Epub 2012 Oct 12.
• [6] MiR-1827 functions as a tumor suppressor in lung adenocarcinoma by targeting MYC and FAM83F.J Cell Biochem. 2020 Feb;121(2):1675-1689. doi: 10.1002/jcb.29402. Epub 2019 Oct 8.
• [7] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [8] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [9] Characterizing the genetic basis for nicotine induced cancer development: a transcriptome sequencing study. PLoS One. 2013 Jun 18;8(6):e67252.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.