Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTGU8BE9)

DOT Name Chymotrypsin-like elastase family member 3B (CELA3B)
Synonyms EC 3.4.21.70; Elastase IIIB; Elastase-3B; Protease E
Gene Name CELA3B
Related Disease
Exocrine pancreatic insufficiency ( )
Cholestasis ( )
Congestive heart failure ( )
Dyspepsia ( )
Hereditary chronic pancreatitis ( )
Neoplasm ( )
Pancreas disorder ( )
Pancreatic adenocarcinoma ( )
Pancreatic cancer ( )
Progressive familial intrahepatic cholestasis type 2 ( )
Type-1/2 diabetes ( )
Type-1 diabetes ( )
Chronic pancreatitis ( )
Cystic fibrosis ( )
UniProt ID
CEL3B_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
EC Number
3.4.21.70
Pfam ID
PF00089
Sequence
MMLRLLSSLLLVAVASGYGPPSSRPSSRVVNGEDAVPYSWPWQVSLQYEKSGSFYHTCGG
SLIAPDWVVTAGHCISSSRTYQVVLGEYDRAVKEGPEQVIPINSGDLFVHPLWNRSCVAC
GNDIALIKLSRSAQLGDAVQLASLPPAGDILPNETPCYITGWGRLYTNGPLPDKLQEALL
PVVDYEHCSRWNWWGSSVKKTMVCAGGDIRSGCNGDSGGPLNCPTEDGGWQVHGVTSFVS
AFGCNTRRKPTVFTRVSAFIDWIEETIASH
Function Efficient protease with alanine specificity but only little elastolytic activity.
Tissue Specificity Pancreas. Not detectable in keratinocytes.
KEGG Pathway
Pancreatic secretion (hsa04972 )
Protein digestion and absorption (hsa04974 )

Molecular Interaction Atlas (MIA) of This DOT

14 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Exocrine pancreatic insufficiency DISCZYU2 Definitive Biomarker [1]
Cholestasis DISDJJWE Strong Altered Expression [2]
Congestive heart failure DIS32MEA Strong Altered Expression [3]
Dyspepsia DISYEEY6 Strong Biomarker [4]
Hereditary chronic pancreatitis DISF0J1Q Strong Genetic Variation [5]
Neoplasm DISZKGEW Strong Biomarker [6]
Pancreas disorder DISDH7NI Strong Genetic Variation [7]
Pancreatic adenocarcinoma DISKHX7S Strong Genetic Variation [5]
Pancreatic cancer DISJC981 Strong Biomarker [8]
Progressive familial intrahepatic cholestasis type 2 DISU4A6Q Strong Genetic Variation [9]
Type-1/2 diabetes DISIUHAP Strong Altered Expression [1]
Type-1 diabetes DIS7HLUB Disputed Altered Expression [10]
Chronic pancreatitis DISBUOMJ Limited Biomarker [11]
Cystic fibrosis DIS2OK1Q Limited Biomarker [12]
------------------------------------------------------------------------------------
⏷ Show the Full List of 14 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene increases the methylation of Chymotrypsin-like elastase family member 3B (CELA3B). [13]
------------------------------------------------------------------------------------

References

1 Diagnosis of exocrine pancreatic insufficiency in chronic pancreatitis: (13)C-Mixed Triglyceride Breath Test versus Fecal Elastase.Pancreatology. 2017 Jul-Aug;17(4):580-585. doi: 10.1016/j.pan.2017.03.002. Epub 2017 Mar 6.
2 Fecal elastase 1, serum amylase and lipase levels in children with cholestasis.Pancreatology. 2005;5(4-5):432-7. doi: 10.1159/000086545. Epub 2005 Jun 28.
3 Pancreatic exocrine insufficiency in patients with chronic heart failure and its possible association with appetite loss.PLoS One. 2017 Nov 20;12(11):e0187804. doi: 10.1371/journal.pone.0187804. eCollection 2017.
4 Association of Low Fecal Elastase-1 and Non-Ulcer Dyspepsia.J Clin Med. 2018 Jun 16;7(6):155. doi: 10.3390/jcm7060155.
5 Elastase 3B mutation links to familial pancreatitis with diabetes and pancreatic adenocarcinoma.J Clin Invest. 2019 Aug 1;129(11):4676-4681. doi: 10.1172/JCI129961.
6 Endoscopic Ultrasound Findings in Patients Diagnosed with Exocrine Pancreatic Insufficiency by Low Fecal Elastase-1.Gastroenterol Res Pract. 2019 Aug 14;2019:5290642. doi: 10.1155/2019/5290642. eCollection 2019.
7 Potential for Screening for Pancreatic Exocrine Insufficiency Using the Fecal Elastase-1 Test.Dig Dis Sci. 2017 May;62(5):1119-1130. doi: 10.1007/s10620-017-4524-z. Epub 2017 Mar 17.
8 Identification of pancreatic juice proteins as biomarkers of pancreatic cancer.Oncol Rep. 2010 Jun;23(6):1683-92. doi: 10.3892/or_00000812.
9 Exocrine pancreatic function in children with progressive familial intrahepatic cholestasis type 2.J Pediatr Gastroenterol Nutr. 2006 Apr;42(4):416-8. doi: 10.1097/01.mpg.0000218154.26792.6a.
10 Fecal pancreatic elastase-1 and erythrocyte magnesium levels in diabetes type 1 and type 2.Magnes Res. 2018 Feb 1;31(1):1-10. doi: 10.1684/mrh.2018.0433.
11 Incomplete functional and morphological recovery after acute and acute recurrent pancreatitis in children.J Gastroenterol Hepatol. 2019 Jan;34(1):293-301. doi: 10.1111/jgh.14288. Epub 2018 Jun 28.
12 13C-Mixed Triglyceride Breath Test and Fecal Elastase as an Indirect Pancreatic Function Test in Cystic Fibrosis Infants.J Pediatr Gastroenterol Nutr. 2018 May;66(5):811-815. doi: 10.1097/MPG.0000000000001905.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.