Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHBZK5X)

• DOT Name: Epithelial cell adhesion molecule (EPCAM)
• Synonyms: Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD antigen CD326
• Gene Name: EPCAM
• Related Disease:
  Congenital diarrhea 5 with tufting enteropathy
  Lynch syndrome
  Lynch syndrome 8
  Hereditary breast carcinoma
• UniProt ID: EPCAM_HUMAN
• PDB ID: 4MZV; 6I07
• Pfam ID: PF21283 ; PF18635 ; PF00086
• Sequence:
  MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICS
  KLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVN
  TAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKF
  ITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQL
  DLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVVAGIVVLVISRKKRMAKYEKA
  EIKEMGEMHRELNA
• Function: May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.
• Tissue Specificity: Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.
• Reactome Pathway: Cell surface interactions at the vascular wall (R-HSA-202733)

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Congenital diarrhea 5 with tufting enteropathy	DISPAMX4	Definitive	Autosomal recessive	[1]
Lynch syndrome	DIS3IW5F	Definitive	Autosomal dominant	[2]
Lynch syndrome 8	DISWDJTO	Definitive	Autosomal dominant	[1]
Hereditary breast carcinoma	DISAEZT5	Refuted	Autosomal dominant	[2]

This DOT Affected the Drug Response of 4 Drug(s)

Drug Name	Drug ID	Highest Status	Interaction	REF
Doxorubicin	DMVP5YE	Approved	Epithelial cell adhesion molecule (EPCAM) affects the response to substance of Doxorubicin.	[29]
Arsenic trioxide	DM61TA4	Approved	Epithelial cell adhesion molecule (EPCAM) decreases the response to substance of Arsenic trioxide.	[30]
Topotecan	DMP6G8T	Approved	Epithelial cell adhesion molecule (EPCAM) affects the response to substance of Topotecan.	[29]
Vinblastine	DM5TVS3	Approved	Epithelial cell adhesion molecule (EPCAM) affects the response to substance of Vinblastine.	[29]

3 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Epithelial cell adhesion molecule (EPCAM).	[3]
Arsenic	DMTL2Y1	Approved	Arsenic affects the methylation of Epithelial cell adhesion molecule (EPCAM).	[8]
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene decreases the methylation of Epithelial cell adhesion molecule (EPCAM).	[20]

25 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[4]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[5]
Cupric Sulfate	DMP0NFQ	Approved	Cupric Sulfate decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[6]
Cisplatin	DMRHGI9	Approved	Cisplatin increases the expression of Epithelial cell adhesion molecule (EPCAM).	[7]
Temozolomide	DMKECZD	Approved	Temozolomide decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[9]
Triclosan	DMZUR4N	Approved	Triclosan decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[10]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Epithelial cell adhesion molecule (EPCAM).	[11]
Marinol	DM70IK5	Approved	Marinol increases the expression of Epithelial cell adhesion molecule (EPCAM).	[12]
Panobinostat	DM58WKG	Approved	Panobinostat increases the expression of Epithelial cell adhesion molecule (EPCAM).	[13]
Paclitaxel	DMLB81S	Approved	Paclitaxel decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[14]
Crizotinib	DM4F29C	Approved	Crizotinib decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[15]
Vinorelbine	DMVXFYE	Approved	Vinorelbine increases the expression of Epithelial cell adhesion molecule (EPCAM).	[16]
SNDX-275	DMH7W9X	Phase 3	SNDX-275 increases the expression of Epithelial cell adhesion molecule (EPCAM).	[13]
Curcumin	DMQPH29	Phase 3	Curcumin decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[17]
Seocalcitol	DMKL9QO	Phase 3	Seocalcitol decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[18]
Napabucasin	DMDZ6Q3	Phase 3	Napabucasin decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[19]
Belinostat	DM6OC53	Phase 2	Belinostat increases the expression of Epithelial cell adhesion molecule (EPCAM).	[13]
(+)-JQ1	DM1CZSJ	Phase 1	(+)-JQ1 decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[21]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[22]
Eugenol	DM7US1H	Patented	Eugenol decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[23]
SB-431542	DM0YOXQ	Preclinical	SB-431542 increases the expression of Epithelial cell adhesion molecule (EPCAM).	[24]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Epithelial cell adhesion molecule (EPCAM).	[25]
Trichostatin A	DM9C8NX	Investigative	Trichostatin A increases the expression of Epithelial cell adhesion molecule (EPCAM).	[26]
Nitrobenzanthrone	DMN6L70	Investigative	Nitrobenzanthrone decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[27]
Ginsenoside RG3	DMFN58T	Investigative	Ginsenoside RG3 decreases the expression of Epithelial cell adhesion molecule (EPCAM).	[28]

References

• [1] Classification of Genes: Standardized Clinical Validity Assessment of Gene-Disease Associations Aids Diagnostic Exome Analysis and Reclassifications. Hum Mutat. 2017 May;38(5):600-608. doi: 10.1002/humu.23183. Epub 2017 Feb 13.
• [2] Technical standards for the interpretation and reporting of constitutional copy-number variants: a joint consensus recommendation of the American College of Medical Genetics and Genomics (ACMG) and the Clinical Genome Resource (ClinGen). Genet Med. 2020 Feb;22(2):245-257. doi: 10.1038/s41436-019-0686-8. Epub 2019 Nov 6.
• [3] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [4] Integrative "-Omics" analysis in primary human hepatocytes unravels persistent mechanisms of cyclosporine A-induced cholestasis. Chem Res Toxicol. 2016 Dec 19;29(12):2164-2174.
• [5] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [6] Physiological and toxicological transcriptome changes in HepG2 cells exposed to copper. Physiol Genomics. 2009 Aug 7;38(3):386-401.
• [7] Cisplatin treatment of primary and metastatic epithelial ovarian carcinomas generates residual cells with mesenchymal stem cell-like profile. J Cell Biochem. 2011 Oct;112(10):2850-64. doi: 10.1002/jcb.23199.
• [8] Prenatal arsenic exposure and the epigenome: identifying sites of 5-methylcytosine alterations that predict functional changes in gene expression in newborn cord blood and subsequent birth outcomes. Toxicol Sci. 2015 Jan;143(1):97-106. doi: 10.1093/toxsci/kfu210. Epub 2014 Oct 10.
• [9] Temozolomide induces activation of Wnt/-catenin signaling in glioma cells via PI3K/Akt pathway: implications in glioma therapy. Cell Biol Toxicol. 2020 Jun;36(3):273-278. doi: 10.1007/s10565-019-09502-7. Epub 2019 Nov 22.
• [10] Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
• [11] Methylation status of the Ep-CAM promoter region in human breast cancer cell lines and breast cancer tissue. Cancer Lett. 2007 Feb 8;246(1-2):253-61. doi: 10.1016/j.canlet.2006.03.002. Epub 2006 Apr 18.
• [12] JunD is involved in the antiproliferative effect of Delta9-tetrahydrocannabinol on human breast cancer cells. Oncogene. 2008 Aug 28;27(37):5033-44.
• [13] A transcriptome-based classifier to identify developmental toxicants by stem cell testing: design, validation and optimization for histone deacetylase inhibitors. Arch Toxicol. 2015 Sep;89(9):1599-618.
• [14] Identification of selective inhibitors of cancer stem cells by high-throughput screening. Cell. 2009 Aug 21;138(4):645-659. doi: 10.1016/j.cell.2009.06.034. Epub 2009 Aug 13.
• [15] Enhancement of the antiproliferative activity of gemcitabine by modulation of c-Met pathway in pancreatic cancer. Curr Pharm Des. 2013;19(5):940-50.
• [16] Adenocarcinoma cells exposed in vitro to Navelbine or Taxol increase Ep-CAM expression through a novel mechanism. Cancer Immunol Immunother. 2003 Jul;52(7):429-37. doi: 10.1007/s00262-003-0386-7. Epub 2003 Apr 15.
• [17] Curcumin suppresses the stemness of non-small cell lung cancer cells via promoting the nuclear-cytoplasm translocation of TAZ. Environ Toxicol. 2021 Jun;36(6):1135-1142. doi: 10.1002/tox.23112. Epub 2021 Feb 4.
• [18] Expression profiling in squamous carcinoma cells reveals pleiotropic effects of vitamin D3 analog EB1089 signaling on cell proliferation, differentiation, and immune system regulation. Mol Endocrinol. 2002 Jun;16(6):1243-56.
• [19] Suppression of cancer relapse and metastasis by inhibiting cancer stemness. Proc Natl Acad Sci U S A. 2015 Feb 10;112(6):1839-44. doi: 10.1073/pnas.1424171112. Epub 2015 Jan 20.
• [20] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [21] CCAT1 is an enhancer-templated RNA that predicts BET sensitivity in colorectal cancer. J Clin Invest. 2016 Feb;126(2):639-52.
• [22] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [23] Eugenol restricts Cancer Stem Cell population by degradation of -catenin via N-terminal Ser37 phosphorylation-an in vivo and in vitro experimental evaluation. Chem Biol Interact. 2020 Jan 25;316:108938. doi: 10.1016/j.cbi.2020.108938. Epub 2020 Jan 8.
• [24] Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts. J Biol Chem. 2015 Apr 3;290(14):8834-48.
• [25] Long-term exposure to bisphenol A or benzo(a)pyrene alters the fate of human mammary epithelial stem cells in response to BMP2 and BMP4, by pre-activating BMP signaling. Cell Death Differ. 2017 Jan;24(1):155-166. doi: 10.1038/cdd.2016.107. Epub 2016 Oct 14.
• [26] From transient transcriptome responses to disturbed neurodevelopment: role of histone acetylation and methylation as epigenetic switch between reversible and irreversible drug effects. Arch Toxicol. 2014 Jul;88(7):1451-68.
• [27] 3-Nitrobenzanthrone promotes malignant transformation in human lung epithelial cells through the epiregulin-signaling pathway. Cell Biol Toxicol. 2022 Oct;38(5):865-887. doi: 10.1007/s10565-021-09612-1. Epub 2021 May 25.
• [28] Ginsenoside Rg3 attenuates the osimertinib resistance by reducing the stemness of non-small cell lung cancer cells. Environ Toxicol. 2020 Jun;35(6):643-651. doi: 10.1002/tox.22899. Epub 2020 Jan 9.
• [29] Gene expression profiling of 30 cancer cell lines predicts resistance towards 11 anticancer drugs at clinically achieved concentrations. Int J Cancer. 2006 Apr 1;118(7):1699-712. doi: 10.1002/ijc.21570.
• [30] The NRF2-mediated oxidative stress response pathway is associated with tumor cell resistance to arsenic trioxide across the NCI-60 panel. BMC Med Genomics. 2010 Aug 13;3:37. doi: 10.1186/1755-8794-3-37.