Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTHRSSGH)

DOT Name Metal transporter CNNM1 (CNNM1)
Synonyms Ancient conserved domain-containing protein 1; Cyclin-M1
Gene Name CNNM1
Related Disease
Melanoma ( )
Myopathy ( )
Ochoa syndrome ( )
Peripheral arterial disease ( )
Prostate cancer ( )
Prostate carcinoma ( )
Small-cell lung cancer ( )
Non-insulin dependent diabetes ( )
UniProt ID
CNNM1_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
Pfam ID
PF00571 ; PF01595
Sequence
MAAAAAAAAAVGVRLRDCCSRGAVLLLFFSLSPRPPAAAAWLLGLRPEDTAGGRVSLEGG
TLRAAEGTSFLLRVYFQPGPPATAAPVPSPTLNSGENGTGDWAPRLVFIEEPPGGGGVAP
SAVPTRPPGPQRCREQSDWASDVEVLGPLRPGGVAGSALVQVRVRELRKGEAERGGAGGG
GKLFSLCAWDGRAWHHHGAAGGFLLRVRPRLYGPGGDLLPPAWLRALGALLLLALSALFS
GLRLSLLSLDPVELRVLRNSGSAAEQEQARRVQAVRGRGTHLLCTLLLGQAGANAALAGW
LYTSLPPGFGGTGEDYSEEGIHFPWLPALVCTGAVFLGAEICPYSVCSRHGLAIASHSVC
LTRLLMAAAFPVCYPLGRLLDWALRQEISTFYTREKLLETLRAADPYSDLVKEELNIIQG
ALELRTKVVEEVLTPLGDCFMLRSDAVLDFATVSEILRSGYTRIPVYEGDQRHNIVDILF
VKDLAFVDPDDCTPLLTVTRFYNRPLHCVFNDTRLDTVLEEFKKGKSHLAIVQRVNNEGE
GDPFYEVMGIVTLEDIIEEIIKSEILDETDLYTDNRKKQRVPQRERKRHDFSLFKLSDTE
MRVKISPQLLLATHRFMATEVEPFKSLYLSEKILLRLLKHPNVIQELKFDEKNKKAPEHY
LYQRNRPVDYFVLLLQGKVEVEVGKEGLRFENGAFTYYGVPAIMTTACSDNDVRKVGSLA
GSSVFLNRSPSRCSGLNRSESPNRERSDFGGSNTQLYSSSNNLYMPDYSVHILSDVQFVK
ITRQQYQNALTACHMDSSPQSPDMEAFTDGDSTKAPTTRGTPQTPKDDPAITLLNNRNSL
PCSRSDGLRSPSEVVYLRMEELAFTQEEMTDFEEHSTQQLTLSPAAVPTRAASDSECCNI
NLDTETSPCSSDFEENVGKKLLRTLSGQKRKRSPEGERTSEDNSNLTPLIT
Function Probable metal transporter.
Tissue Specificity Restricted to brain and testis.

Molecular Interaction Atlas (MIA) of This DOT

8 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Melanoma DIS1RRCY Strong Biomarker [1]
Myopathy DISOWG27 Strong Altered Expression [2]
Ochoa syndrome DIS1MDEZ Strong Biomarker [3]
Peripheral arterial disease DIS78WFB Strong Genetic Variation [4]
Prostate cancer DISF190Y Strong Altered Expression [5]
Prostate carcinoma DISMJPLE Strong Altered Expression [5]
Small-cell lung cancer DISK3LZD moderate Genetic Variation [6]
Non-insulin dependent diabetes DISK1O5Z Limited Genetic Variation [7]
------------------------------------------------------------------------------------
⏷ Show the Full List of 8 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Valproate DMCFE9I Approved Valproate increases the methylation of Metal transporter CNNM1 (CNNM1). [8]
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Metal transporter CNNM1 (CNNM1). [13]
------------------------------------------------------------------------------------
6 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Estradiol DMUNTE3 Approved Estradiol increases the expression of Metal transporter CNNM1 (CNNM1). [9]
Testosterone DM7HUNW Approved Testosterone decreases the expression of Metal transporter CNNM1 (CNNM1). [10]
Triclosan DMZUR4N Approved Triclosan decreases the expression of Metal transporter CNNM1 (CNNM1). [11]
Urethane DM7NSI0 Phase 4 Urethane decreases the expression of Metal transporter CNNM1 (CNNM1). [12]
Leflunomide DMR8ONJ Phase 1 Trial Leflunomide increases the expression of Metal transporter CNNM1 (CNNM1). [14]
PMID28460551-Compound-2 DM4DOUB Patented PMID28460551-Compound-2 increases the expression of Metal transporter CNNM1 (CNNM1). [15]
------------------------------------------------------------------------------------
⏷ Show the Full List of 6 Drug(s)

References

1 Silencing of Peroxiredoxin 2 and aberrant methylation of 33 CpG islands in putative promoter regions in human malignant melanomas.Cancer Res. 2006 Jun 15;66(12):6080-6. doi: 10.1158/0008-5472.CAN-06-0157.
2 The atypical calpains: evolutionary analyses and roles in Caenorhabditis elegans cellular degeneration.PLoS Genet. 2012;8(3):e1002602. doi: 10.1371/journal.pgen.1002602. Epub 2012 Mar 29.
3 High resolution mapping and mutation analyses of candidate genes in the urofacial syndrome (UFS) critical region.Am J Med Genet A. 2003 May 15;119A(1):9-14. doi: 10.1002/ajmg.a.20042.
4 Genetic Variants in the Bone Morphogenic Protein Gene Family Modify the Association between Residential Exposure to Traffic and Peripheral Arterial Disease.PLoS One. 2016 Apr 15;11(4):e0152670. doi: 10.1371/journal.pone.0152670. eCollection 2016.
5 Ginsenoside Rh2 Inhibits Angiogenesis in Prostate Cancer by Targeting CNNM1.J Nanosci Nanotechnol. 2019 Apr 1;19(4):1942-1950. doi: 10.1166/jnn.2019.16404.
6 Pathways Impacted by Genomic Alterations in Pulmonary Carcinoid Tumors.Clin Cancer Res. 2018 Apr 1;24(7):1691-1704. doi: 10.1158/1078-0432.CCR-17-0252. Epub 2018 Jan 19.
7 Genetic variations in magnesium-related ion channels may affect diabetes risk among African American and Hispanic American women.J Nutr. 2015 Mar;145(3):418-24. doi: 10.3945/jn.114.203489. Epub 2015 Jan 7.
8 Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
9 17-Estradiol Activates HSF1 via MAPK Signaling in ER-Positive Breast Cancer Cells. Cancers (Basel). 2019 Oct 11;11(10):1533. doi: 10.3390/cancers11101533.
10 The exosome-like vesicles derived from androgen exposed-prostate stromal cells promote epithelial cells proliferation and epithelial-mesenchymal transition. Toxicol Appl Pharmacol. 2021 Jan 15;411:115384. doi: 10.1016/j.taap.2020.115384. Epub 2020 Dec 25.
11 Transcriptome and DNA methylome dynamics during triclosan-induced cardiomyocyte differentiation toxicity. Stem Cells Int. 2018 Oct 29;2018:8608327.
12 Ethyl carbamate induces cell death through its effects on multiple metabolic pathways. Chem Biol Interact. 2017 Nov 1;277:21-32.
13 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
14 Endoplasmic reticulum stress and MAPK signaling pathway activation underlie leflunomide-induced toxicity in HepG2 Cells. Toxicology. 2017 Dec 1;392:11-21.
15 Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.