Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTIUZ6CF)

• DOT Name: Cytochrome P450 20A1 (CYP20A1)
• Synonyms: EC 1.14.-.-
• Gene Name: CYP20A1
• Related Disease:
  Late-onset Parkinson disease
  Lung cancer
  Lung carcinoma
  Parkinson disease
  Yellow fever virus infection
• UniProt ID: CP20A_HUMAN
• EC Number: 1.14.-.-
• Pfam ID: PF00067
• Sequence:
  MLDFAIFAVTFLLALVGAVLYLYPASRQAAGIPGITPTEEKDGNLPDIVNSGSLHEFLVN
  LHERYGPVVSFWFGRRLVVSLGTVDVLKQHINPNKTSDPFETMLKSLLRYQSGGGSVSEN
  HMRKKLYENGVTDSLKSNFALLLKLSEELLDKWLSYPETQHVPLSQHMLGFAMKSVTQMV
  MGSTFEDDQEVIRFQKNHGTVWSEIGKGFLDGSLDKNMTRKKQYEDALMQLESVLRNIIK
  ERKGRNFSQHIFIDSLVQGNLNDQQILEDSMIFSLASCIITAKLCTWAICFLTTSEEVQK
  KLYEEINQVFGNGPVTPEKIEQLRYCQHVLCETVRTAKLTPVSAQLQDIEGKIDRFIIPR
  ETLVLYALGVVLQDPNTWPSPHKFDPDRFDDELVMKTFSSLGFSGTQECPELRFAYMVTT
  VLLSVLVKRLHLLSVEGQVIETKYELVTSSREEAWITVSKRY

Molecular Interaction Atlas (MIA) of This DOT

5 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Late-onset Parkinson disease	DIS9IOUI	Strong	Genetic Variation	[1]
Lung cancer	DISCM4YA	Strong	Genetic Variation	[2]
Lung carcinoma	DISTR26C	Strong	Genetic Variation	[2]
Parkinson disease	DISQVHKL	Strong	Genetic Variation	[1]
Yellow fever virus infection	DISK0X5T	Strong	Altered Expression	[3]

10 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate decreases the expression of Cytochrome P450 20A1 (CYP20A1).	[4]
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Cytochrome P450 20A1 (CYP20A1).	[5]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Cytochrome P450 20A1 (CYP20A1).	[6]
Acetaminophen	DMUIE76	Approved	Acetaminophen increases the expression of Cytochrome P450 20A1 (CYP20A1).	[7]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Cytochrome P450 20A1 (CYP20A1).	[8]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Cytochrome P450 20A1 (CYP20A1).	[8]
Diethylstilbestrol	DMN3UXQ	Approved	Diethylstilbestrol decreases the expression of Cytochrome P450 20A1 (CYP20A1).	[9]
PMID28460551-Compound-2	DM4DOUB	Patented	PMID28460551-Compound-2 increases the expression of Cytochrome P450 20A1 (CYP20A1).	[11]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Cytochrome P450 20A1 (CYP20A1).	[12]
GALLICACID	DM6Y3A0	Investigative	GALLICACID decreases the expression of Cytochrome P450 20A1 (CYP20A1).	[13]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Benzo(a)pyrene	DMN7J43	Phase 1	Benzo(a)pyrene increases the methylation of Cytochrome P450 20A1 (CYP20A1).	[10]

References

• [1] Genetic variability of the CYP 2D6 gene is not a risk factor for sporadic Parkinson's disease.Ann Neurol. 1996 Sep;40(3):463-5. doi: 10.1002/ana.410400319.
• [2] Gene polymorphism of cytochrome P450 significantly affects lung cancer susceptibility.Cancer Med. 2019 Aug;8(10):4892-4905. doi: 10.1002/cam4.2367. Epub 2019 Jul 1.
• [3] Bacteria-mediated modification of insecticide toxicity in the yellow fever mosquito, Aedes aegypti.Pestic Biochem Physiol. 2019 Nov;161:77-85. doi: 10.1016/j.pestbp.2019.07.016. Epub 2019 Aug 2.
• [4] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [5] Comparison of HepG2 and HepaRG by whole-genome gene expression analysis for the purpose of chemical hazard identification. Toxicol Sci. 2010 May;115(1):66-79.
• [6] Transcriptional and Metabolic Dissection of ATRA-Induced Granulocytic Differentiation in NB4 Acute Promyelocytic Leukemia Cells. Cells. 2020 Nov 5;9(11):2423. doi: 10.3390/cells9112423.
• [7] Predictive toxicology using systemic biology and liver microfluidic "on chip" approaches: application to acetaminophen injury. Toxicol Appl Pharmacol. 2012 Mar 15;259(3):270-80.
• [8] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [9] Identification of biomarkers and outcomes of endocrine disruption in human ovarian cortex using In Vitro Models. Toxicology. 2023 Feb;485:153425. doi: 10.1016/j.tox.2023.153425. Epub 2023 Jan 5.
• [10] Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
• [11] Cell-based two-dimensional morphological assessment system to predict cancer drug-induced cardiotoxicity using human induced pluripotent stem cell-derived cardiomyocytes. Toxicol Appl Pharmacol. 2019 Nov 15;383:114761. doi: 10.1016/j.taap.2019.114761. Epub 2019 Sep 15.
• [12] Identification of mechanisms of action of bisphenol a-induced human preadipocyte differentiation by transcriptional profiling. Obesity (Silver Spring). 2014 Nov;22(11):2333-43.
• [13] Gene expression profile analysis of gallic acid-induced cell death process. Sci Rep. 2021 Aug 18;11(1):16743. doi: 10.1038/s41598-021-96174-1.