Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTK3VOI3)

DOT Name Serine protease inhibitor Kazal-type 7 (SPINK7)
Synonyms Esophagus cancer-related gene 2 protein; ECRG-2
Gene Name SPINK7
Related Disease
Advanced cancer ( )
Carcinoma of esophagus ( )
Chronic pancreatitis ( )
Eosinophilic esophagitis ( )
Esophageal cancer ( )
Esophageal squamous cell carcinoma ( )
Hepatocellular carcinoma ( )
Lung cancer ( )
Lung carcinoma ( )
Metastatic malignant neoplasm ( )
Neoplasm of esophagus ( )
Pancreatic adenocarcinoma ( )
Pancreatic cancer ( )
Psoriasis ( )
Relapsing-remitting multiple sclerosis ( )
Skin disease ( )
Squamous cell carcinoma ( )
UniProt ID
ISK7_HUMAN
3D Structure
Download
2D Sequence (FASTA)
Download
3D Structure (PDB)
Download
PDB ID
2LEO
Pfam ID
PF00050
Sequence
MKITGGLLLLCTVVYFCSSSEAASLSPKKVDCSIYKKYPVVAIPCPITYLPVCGSDYITY
GNECHLCTESLKSNGRVQFLHDGSC
Function Probable serine protease inhibitor.

Molecular Interaction Atlas (MIA) of This DOT

17 Disease(s) Related to This DOT
Disease Name Disease ID Evidence Level Mode of Inheritance REF
Advanced cancer DISAT1Z9 Strong Biomarker [1]
Carcinoma of esophagus DISS6G4D Strong Biomarker [2]
Chronic pancreatitis DISBUOMJ Strong Genetic Variation [3]
Eosinophilic esophagitis DISR8WSB Strong Biomarker [4]
Esophageal cancer DISGB2VN Strong Biomarker [2]
Esophageal squamous cell carcinoma DIS5N2GV Strong Biomarker [5]
Hepatocellular carcinoma DIS0J828 Strong Biomarker [6]
Lung cancer DISCM4YA Strong Biomarker [7]
Lung carcinoma DISTR26C Strong Biomarker [7]
Metastatic malignant neoplasm DIS86UK6 Strong Altered Expression [8]
Neoplasm of esophagus DISOLKAQ Strong Biomarker [2]
Pancreatic adenocarcinoma DISKHX7S Strong Genetic Variation [3]
Pancreatic cancer DISJC981 Strong Genetic Variation [3]
Psoriasis DIS59VMN Strong Altered Expression [1]
Relapsing-remitting multiple sclerosis DISSXFCF Strong Genetic Variation [9]
Skin disease DISDW8R6 Strong Biomarker [1]
Squamous cell carcinoma DISQVIFL Limited Genetic Variation [10]
------------------------------------------------------------------------------------
⏷ Show the Full List of 17 Disease(s)
Molecular Interaction Atlas (MIA) Jump to Detail Molecular Interaction Atlas of This DOT
2 Drug(s) Affected the Gene/Protein Processing of This DOT
Drug Name Drug ID Highest Status Interaction REF
Sodium lauryl sulfate DMLJ634 Approved Sodium lauryl sulfate increases the expression of Serine protease inhibitor Kazal-type 7 (SPINK7). [11]
Milchsaure DM462BT Investigative Milchsaure decreases the expression of Serine protease inhibitor Kazal-type 7 (SPINK7). [13]
------------------------------------------------------------------------------------
1 Drug(s) Affected the Post-Translational Modifications of This DOT
Drug Name Drug ID Highest Status Interaction REF
Benzo(a)pyrene DMN7J43 Phase 1 Benzo(a)pyrene affects the methylation of Serine protease inhibitor Kazal-type 7 (SPINK7). [12]
------------------------------------------------------------------------------------

References

1 The serine protease inhibitor of Kazal-type 7 (SPINK7) is expressed in human skin.Arch Dermatol Res. 2017 Nov;309(9):767-771. doi: 10.1007/s00403-017-1773-9. Epub 2017 Aug 29.
2 ECRG2 enhances the anti-cancer effects of cisplatin in cisplatin-resistant esophageal cancer cells via upregulation of p53 and downregulation of PCNA.World J Gastroenterol. 2017 Mar 14;23(10):1796-1803. doi: 10.3748/wjg.v23.i10.1796.
3 Short tandem repeat polymorphisms of exon 4 in Kazal-type gene ECRG2 in pancreatic carcinoma and chronic pancreatitis.Anticancer Res. 2007 Jan-Feb;27(1A):69-73.
4 Role of genetics, environment, and their interactions in the pathogenesis of eosinophilic esophagitis.Curr Opin Immunol. 2019 Oct;60:46-53. doi: 10.1016/j.coi.2019.04.004. Epub 2019 May 25.
5 MicroRNA-1322 regulates ECRG2 allele specifically and acts as a potential biomarker in patients with esophageal squamous cell carcinoma.Mol Carcinog. 2013 Aug;52(8):581-90. doi: 10.1002/mc.21880. Epub 2012 Feb 7.
6 Suppression of hepatocarcinoma model in vitro and in vivo by ECRG2 delivery using adenoviral vector.Cancer Gene Ther. 2012 Dec;19(12):875-9. doi: 10.1038/cgt.2012.77. Epub 2012 Oct 19.
7 ECRG2 regulates ECM degradation and uPAR/FPRL1 pathway contributing cell invasion/migration.Cancer Lett. 2010 Apr 1;290(1):87-95. doi: 10.1016/j.canlet.2009.09.001. Epub 2009 Sep 30.
8 ECRG2 inhibits cancer cell migration, invasion and metastasis through the down-regulation of uPA/plasmin activity.Carcinogenesis. 2007 Nov;28(11):2274-81. doi: 10.1093/carcin/bgm140. Epub 2007 Jun 29.
9 The impact of multiple sclerosis onset symptom on cardiac repolarization.Brain Behav. 2017 Jun 5;7(7):e00742. doi: 10.1002/brb3.742. eCollection 2017 Jul.
10 Short tandem repeat polymorphism in exon 4 of esophageal cancer related gene 2 predicts relapse of oral squamous cell carcinoma.Oral Oncol. 2008 Feb;44(2):143-7. doi: 10.1016/j.oraloncology.2007.01.013. Epub 2007 Apr 5.
11 CXCL14 downregulation in human keratinocytes is a potential biomarker for a novel in vitro skin sensitization test. Toxicol Appl Pharmacol. 2020 Jan 1;386:114828. doi: 10.1016/j.taap.2019.114828. Epub 2019 Nov 14.
12 Air pollution and DNA methylation alterations in lung cancer: A systematic and comparative study. Oncotarget. 2017 Jan 3;8(1):1369-1391. doi: 10.18632/oncotarget.13622.
13 Transcriptional profiling of lactic acid treated reconstructed human epidermis reveals pathways underlying stinging and itch. Toxicol In Vitro. 2019 Jun;57:164-173.