Details of Drug Off-Target (DOT)

General Information of Drug Off-Target (DOT) (ID: OTKPULAA)

• DOT Name: Chromatin complexes subunit BAP18 (C17ORF49)
• Synonyms: BPTF-associated protein of 18 kDa
• Gene Name: C17ORF49
• Related Disease:
  Benign prostatic hyperplasia
  Neoplasm
  Prostate cancer
  Prostate carcinoma
• UniProt ID: BAP18_HUMAN
• Sequence:
  MTSASTKVGEIFSAAGAAFTKLGELTMQLHPVADSSPAGAKWTETEIEMLRAAVKRFGDD
  LNHISCVIKERTVAQIKATVKRKVYEDSGIPLPAESPKKGPKKVASGVLSPPPAAPPPSS
  SSVPEAGGPPIKKQKADVTLSALNDSDANSDVVDIEGLGETPPAKKLNFDQA
• Function: Component of chromatin complexes such as the MLL1/MLL and NURF complexes.
• KEGG Pathway: ATP-dependent chromatin remodeling (hsa03082)

Molecular Interaction Atlas (MIA) of This DOT

4 Disease(s) Related to This DOT

Disease Name	Disease ID	Evidence Level	Mode of Inheritance	REF
Benign prostatic hyperplasia	DISI3CW2	Disputed	Altered Expression	[1]
Neoplasm	DISZKGEW	Disputed	Biomarker	[1]
Prostate cancer	DISF190Y	Disputed	Altered Expression	[1]
Prostate carcinoma	DISMJPLE	Disputed	Altered Expression	[1]

1 Drug(s) Affected the Post-Translational Modifications of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Valproate	DMCFE9I	Approved	Valproate increases the methylation of Chromatin complexes subunit BAP18 (C17ORF49).	[2]

7 Drug(s) Affected the Gene/Protein Processing of This DOT

Drug Name	Drug ID	Highest Status	Interaction	REF
Ciclosporin	DMAZJFX	Approved	Ciclosporin increases the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[3]
Tretinoin	DM49DUI	Approved	Tretinoin decreases the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[4]
Cisplatin	DMRHGI9	Approved	Cisplatin affects the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[5]
Estradiol	DMUNTE3	Approved	Estradiol decreases the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[6]
Ivermectin	DMDBX5F	Approved	Ivermectin decreases the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[7]
Decitabine	DMQL8XJ	Approved	Decitabine affects the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[5]
Bisphenol A	DM2ZLD7	Investigative	Bisphenol A increases the expression of Chromatin complexes subunit BAP18 (C17ORF49).	[8]

References

• [1] BAP18 coactivates androgen receptor action and promotes prostate cancer progression.Nucleic Acids Res. 2016 Sep 30;44(17):8112-28. doi: 10.1093/nar/gkw472. Epub 2016 May 25.
• [2] Integrative omics data analyses of repeated dose toxicity of valproic acid in vitro reveal new mechanisms of steatosis induction. Toxicology. 2018 Jan 15;393:160-170.
• [3] Integrating multiple omics to unravel mechanisms of Cyclosporin A induced hepatotoxicity in vitro. Toxicol In Vitro. 2015 Apr;29(3):489-501.
• [4] Development of a neural teratogenicity test based on human embryonic stem cells: response to retinoic acid exposure. Toxicol Sci. 2011 Dec;124(2):370-7.
• [5] Acute hypersensitivity of pluripotent testicular cancer-derived embryonal carcinoma to low-dose 5-aza deoxycytidine is associated with global DNA Damage-associated p53 activation, anti-pluripotency and DNA demethylation. PLoS One. 2012;7(12):e53003. doi: 10.1371/journal.pone.0053003. Epub 2012 Dec 27.
• [6] Genistein and bisphenol A exposure cause estrogen receptor 1 to bind thousands of sites in a cell type-specific manner. Genome Res. 2012 Nov;22(11):2153-62.
• [7] Quantitative proteomics reveals a broad-spectrum antiviral property of ivermectin, benefiting for COVID-19 treatment. J Cell Physiol. 2021 Apr;236(4):2959-2975. doi: 10.1002/jcp.30055. Epub 2020 Sep 22.
• [8] Low-dose Bisphenol A exposure alters the functionality and cellular environment in a human cardiomyocyte model. Environ Pollut. 2023 Oct 15;335:122359. doi: 10.1016/j.envpol.2023.122359. Epub 2023 Aug 9.